PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_A79538646.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 807aa    MW: 88559.6 Da    PI: 6.1035
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_A79538646.4genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS333.53.8e-1024227971373
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++ L++cA+av++gd++  ++lL ++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s
  Traes_4BS_A79538646.4 422 LRTMLIHCAQAVATGDHRGSNELLRQIKQHSSPKGDATQRLAYCFAEGLEARLAGTGSHVYQSLVAKSTS---VGEFLRAYKLYMAAS 506
                            5789***************************************************************999...9************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                             + k+ ++   + I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gv
  Traes_4BS_A79538646.4 507 SFRKVNFIFVGKIIMDAMVGKSRLHIVDYNVEYGFQWPGLLQMLAEREGGPPEVRITGIDVPQPGfrPAFQIEETGRRLSKCAQEFGV 594
                            ****************************************************************999********************* PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                            pf+++  +  +le+++ e+L+++p+E+l+V ++    +l+desv ++      +rd vL+ +++++P+v++ +  +  ++++ F++rf
  Traes_4BS_A79538646.4 595 PFKYHG-IPAKLETVHAEDLNIDPDEVLIVTSQCGFSNLMDESVIMDRqdipsPRDMVLSNIRNMRPDVFIDCVVNGTYSAPFFVTRF 681
                            ******.799******************************99887665555669********************************** PP

                   GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             eal +ysa fd+l+a++pr++++r  +Er ++g+ + nv+acega+r+ r et+++W+ r ++aG+++vpls+ ++k +k  ++  +
  Traes_4BS_A79538646.4 682 REALFTYSAQFDMLDATIPRDNDDRLLIERDIFGPCALNVIACEGADRVDRPETYKQWQVRGHRAGLRQVPLSSAVVKLVKDKVKSLY 769
                            **************************************************************************************** PP

                   GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                             + + ++ ++ +l++gWk+r L+++S W
  Traes_4BS_A79538646.4 770 HKDFLIDVDNRWLLQGWKGRVLYAMSTW 797
                            888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.195396778IPR005202Transcription factor GRAS
PfamPF035141.3E-99422797IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 807 aa     Download sequence    Send to blast
MAATPDEFLR AGDFLADAEP FSPSLFLDLP PTPSPPRAPF APASDDLDFI SRMLMEEDID  60
DKFFYQYPDH PAILSAQHRF AQIISDSNTT PSTDDSANTT VASSTFSSDS ATARSTSSCS  120
DSATNTAKST SSSHSATNTA NSTSCSSSPG GFGPANPTWP YERIDLSQPL QSRPYIGLGF  180
PVDDANNLLF SGVCTPTAGY FGHAPALSKG NNDHFVAPAG QNGRGTGIQS FAAFSNSSAA  240
KTLSNNGTEK AAKPATPPVC RGGPGTPASA FFSGQADGDM DMLNMAFRKG MEEANKFLPT  300
NNTLDAISNR PALRDFTCDQ LKKEEVDRLR MLMFSNGRGR KNRHGVEDLE AEAGRRSKLM  360
MPEQEESGVG EMVEEIMLHG HDIIMKGIED LHIAMGTEAE KNHRKGTGKA ARGRRGASEV  420
DLRTMLIHCA QAVATGDHRG SNELLRQIKQ HSSPKGDATQ RLAYCFAEGL EARLAGTGSH  480
VYQSLVAKST SVGEFLRAYK LYMAASSFRK VNFIFVGKII MDAMVGKSRL HIVDYNVEYG  540
FQWPGLLQML AEREGGPPEV RITGIDVPQP GFRPAFQIEE TGRRLSKCAQ EFGVPFKYHG  600
IPAKLETVHA EDLNIDPDEV LIVTSQCGFS NLMDESVIMD RQDIPSPRDM VLSNIRNMRP  660
DVFIDCVVNG TYSAPFFVTR FREALFTYSA QFDMLDATIP RDNDDRLLIE RDIFGPCALN  720
VIACEGADRV DRPETYKQWQ VRGHRAGLRQ VPLSSAVVKL VKDKVKSLYH KDFLIDVDNR  780
WLLQGWKGRV LYAMSTWVAG DHDNSKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-394267978374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564369.10.0PREDICTED: scarecrow-like protein 34
TrEMBLW5ECN20.0W5ECN2_WHEAT; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]