PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_929E7B27B.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CPP
Protein Properties Length: 835aa    MW: 89962.6 Da    PI: 7.2106
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_929E7B27B.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.8e-16478516240
                    TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Traes_4BS_929E7B27B.2 478 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 516
                            689**********************************96 PP

2TCR49.11.1e-15563602140
                    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  Traes_4BS_929E7B27B.2 563 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 602
                            589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-17477518IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.145478603IPR005172CRC domain
PfamPF036389.6E-12480515IPR005172CRC domain
SMARTSM011141.6E-15563604IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.6E-11565601IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MDTPDRAAAP AAAARAEDSP LFGFIDSLSP IEPLKSAYSG NGLQAYHQSL NAASVSSIFT  60
SPHHNAHKEG SKLSKSSFGD YTENEISMED GTDKNKSPTS STAVRLFACT STITRESHTM  120
ITCSVNEGIV DPPKGPNDLP QPGRFDSGSP DHNTAPCHGV SVRSDLKQDK CPKLEAVQAT  180
NNTVEKRKCL FSSDMQPQDG CQPAKENNEV MGCEWEDLVS VTSGELLAFD SSMDQHHTGV  240
QLAVNNAESC GYLLSKLAGG ADIPDRTHPT TSSQAYYHEM VVGEDKTENG QLFPEDKKTI  300
LSEEIQDNIN EENACIPLGC KVETQQRGVR RRCLVFEASG YSHRTVQKES VGDLSFSTSK  360
GKSSAQNHRN PGKTPSPHVF RGIGLHLNAL ALTSKDKMAC QDPLATALVP SLKTEQDVHG  420
NLLSAGGNFV HSGSGSLDLQ MDNDDCSVGG FLGNDHNSSQ SSSPPKKRRK SDNGDDDSCK  480
RCSCKKSKCL KLYCECFAAG VYCSEPCSCQ GCLNKPIHEE IVLSTRKQIE FRNPLAFAPK  540
VIRMSEAGQE TQEDPKNTPA SARHKRGCNC KKSSCLKKYC ECYQGGVGCS NNCRCETCKN  600
TFGTRDVAVS TENEEMKQEG DQTENREQEK ENDQQKANVH SEDHKLVELV VPITPPLDVS  660
SCLLKQPNFS NAKPPRPCKA RSGSSSRPSK ASETVQSRKT SKAGDSVFIE EMRGILREPS  720
SPGIVKTCSP NGKRVSPPHN ALGVSPSRKG GRKLILKSIP SFPSLAGDAN GGSATCSSDS  780
ATALALGSVL EAGLGSGLII RDRSTTCSPM MVRYLAYELR GKAQGTVREC HVMSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1548060012120Protein lin-54 homolog
5fd3_B2e-1548060012120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1464470PKKRRKS
2465469KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A3B6IJJ70.0A0A3B6IJJ7_WHEAT; Uncharacterized protein
STRINGTraes_4BS_929E7B27B.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-77TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]