PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_344A932261.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 676aa    MW: 75110.1 Da    PI: 6.8565
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_344A932261.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS335.59.9e-1032996702373
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                              +lLl+cA+a+s+++ + a +lL+r+++++sp+gd+ qRla+yf+++L+arla+ +sely++l  s+ s   +++ l+a +l+  ++
  Traes_4BS_344A932261.3 299 HTLLLNCAQALSTDNRHSAVELLKRIRQHSSPKGDAGQRLAHYFANGLEARLAGRGSELYQSLLLSRIS---VADFLKANQLYMAAC 382
                             679************************************************************999998...*************** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                              + k++++ a ++I +av+g++r+Hi+D++++qGlQWp Ll+ La+R++gpp++RiTg++ p++g   +  +eetg+rL++fA+ +g
  Traes_4BS_344A932261.3 383 CCKKVAYIFADKTICNAVAGKRRLHIVDYGLNQGLQWPGLLRMLAAREGGPPEVRITGIDLPQPGfhGAYHIEETGRRLRNFARVFG 469
                             ****************************************************************999999***************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                             vpf+f+  +  + e++++e+L+++++E+l+V +  q  +l+des+  +   +rd+vL+ +k+++P+v+++   + +++++sFl+rf 
  Traes_4BS_344A932261.3 470 VPFKFRG-IPAKRETVRPEDLNIDRDEVLVVISLCQFRHLMDESLGFDGpsPRDQVLNNIKKMRPDVFIHGIMNGSYGATSFLTRFR 555
                             *******.69999*******************************98876669*********************************** PP

                    GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             eal +ysa fd l++++pr++e r  +Er ++gr+  nv+acega+r+er et+++W+ r ++aG++++pl+ +++k +   ++  +
  Traes_4BS_344A932261.3 556 EALFHYSAQFDLLDTTVPRDNEGRLLLERDIFGRSCLNVLACEGADRVERPETYKQWQLRNHRAGLRQLPLNPEVVKLVLDKVKDNY 642
                             *************************************************************************************** PP

                    GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                              + + v+ ++ +l+  Wk+r L++ S+W
  Traes_4BS_344A932261.3 643 HRNFVVDADQRWLLHRWKGRVLYAWSSW 670
                             999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.35272651IPR005202Transcription factor GRAS
PfamPF035143.4E-100299670IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAATPEEFLG QQGFLARLEP PSPSLFLDLP PTPRGGHDDD GHSSFDDMVL PYISRLLMEE  60
GTEDHLFYLY PNHPAVLRAQ QPFAQILVDV ADSASASTST PSPSSSSDAT ASTTPSTATA  120
SASASASPDD APVQISRPSY TDVNGHASAS PDNQSSGLLN GDEMAKQPSS DLFNHLLPGD  180
QDMLNLAFLK GMEEARKFLP PDISLPPIKE GTVVGGGNAA SLKKKRAAPA LEPDVGRPSK  240
LMMPEQEERN MFDEMMFQEH EICMKGTLQN LNGEPEKSSR KKGRSRKTTV DDSEMVDLHT  300
LLLNCAQALS TDNRHSAVEL LKRIRQHSSP KGDAGQRLAH YFANGLEARL AGRGSELYQS  360
LLLSRISVAD FLKANQLYMA ACCCKKVAYI FADKTICNAV AGKRRLHIVD YGLNQGLQWP  420
GLLRMLAARE GGPPEVRITG IDLPQPGFHG AYHIEETGRR LRNFARVFGV PFKFRGIPAK  480
RETVRPEDLN IDRDEVLVVI SLCQFRHLMD ESLGFDGPSP RDQVLNNIKK MRPDVFIHGI  540
MNGSYGATSF LTRFREALFH YSAQFDLLDT TVPRDNEGRL LLERDIFGRS CLNVLACEGA  600
DRVERPETYK QWQLRNHRAG LRQLPLNPEV VKLVLDKVKD NYHRNFVVDA DQRWLLHRWK  660
GRVLYAWSSW VAADAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-443026708374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672260.0AK367226.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
SwissprotO809331e-137SCL9_ARATH; Scarecrow-like protein 9
TrEMBLW5EA100.0W5EA10_WHEAT; Uncharacterized protein
STRINGMLOC_7746.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-134GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]