PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_2EA81743E1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 674aa    MW: 74977.1 Da    PI: 5.7845
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_2EA81743E1.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS336.83.9e-1032976682373
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                              +lLl+cA+a+s+++ + a +lL+r++++++p+gd+ qRla+yf+eAL arla+ +sely++l +++ts   +++ l+a +l+  ++
  Traes_4BS_2EA81743E1.2 297 HTLLLNCAQALSTDNRQTAGELLKRIKQHSTPKGDAAQRLAHYFAEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAAC 380
                             679**************************************************************9999...*************** PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelg 173
                              + k++++ aN++I +av g++r+Hi+D+++sqGlQWp Ll+ La+R++gpp+++iTg++ p++g   +  +eetg+rL++fA+ +g
  Traes_4BS_2EA81743E1.2 381 CCKKVAFIFANKTICNAVVGKSRLHIVDYGLSQGLQWPGLLRMLAAREGGPPEVKITGIDLPQPGfhGAYHIEETGRRLSNFARVFG 467
                             ****************************************************************999999***************** PP

                    GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                             vpf+f+  +a + e++++e+L+++++E+l+V +  +   l+de++  +   +rd+vL+ ++++ P+v+++   + +++++ Fl+rf 
  Traes_4BS_2EA81743E1.2 468 VPFKFHG-IAAKRETVQPEDLNIDRDEVLVVISLCHFRLLMDENLGFDTpsPRDQVLNNIRKMLPDVFIHGIMNGSYGATYFLTRFR 553
                             *******.69999**********************9999999998655444************************************ PP

                    GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             eal  ysa fd l+a++pr++e r  +Er ++gr++ nv+acega+r+er et+++W+ r ++aG++++pl+ +++  +   ++  +
  Traes_4BS_2EA81743E1.2 554 EALFNYSAQFDLLDATVPRDNEGRLLLERDIFGRSALNVIACEGADRVERPETYKQWQLRNHRAGLTQLPLNPDVVRLVLDKVKDNY 640
                             ************************************************************************************999 PP

                    GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                              + + v++++ +l+  Wk+r L+++S W
  Traes_4BS_2EA81743E1.2 641 HKDFVVDDDQRWLLHRWKGRVLYALSTW 668
                             888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.206270649IPR005202Transcription factor GRAS
PfamPF035141.3E-100297668IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAATPEEFLG QQSFLSRLEP PSPSLFLGLP PTPRGVEDGD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF AQILVDVADS ASGSTSALSP SSSTSTFDAT ASTTPSATSP  120
YDAEIQISRP PYTQVLGLAS GSPDTQSSAL LSGDEEAQNP SSDFVTGNYL LPGDQDMLNM  180
AFLKGMEEAK KFLPPNSSLP AMKVDQVVGG ALAGAGLKKK RDTLEPDMGR ASKLMMPEQE  240
EDGARELFDE MMFQEHEICM KGVQQLRIAV DSEPGKNRRK KGRPRRDSSD SEMVDLHTLL  300
LNCAQALSTD NRQTAGELLK RIKQHSTPKG DAAQRLAHYF AEALDARLAG RGSELYQSLM  360
ARRTSVADFL KANQLYMAAC CCKKVAFIFA NKTICNAVVG KSRLHIVDYG LSQGLQWPGL  420
LRMLAAREGG PPEVKITGID LPQPGFHGAY HIEETGRRLS NFARVFGVPF KFHGIAAKRE  480
TVQPEDLNID RDEVLVVISL CHFRLLMDEN LGFDTPSPRD QVLNNIRKML PDVFIHGIMN  540
GSYGATYFLT RFREALFNYS AQFDLLDATV PRDNEGRLLL ERDIFGRSAL NVIACEGADR  600
VERPETYKQW QLRNHRAGLT QLPLNPDVVR LVLDKVKDNY HKDFVVDDDQ RWLLHRWKGR  660
VLYALSTWVA DNAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-423006688374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLW5E9X10.0W5E9X1_WHEAT; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-136GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]