PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_1281828D6.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GeBP
Protein Properties Length: 395aa    MW: 42079.7 Da    PI: 6.352
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_1281828D6.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57383.23.8e-2674168297
                 DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkif 89 
                            +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++sql+eK+rrLK+K ++  +++++g +p+  ++hd++++
  Traes_4BS_1281828D6.2  74 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRSQLSEKLRRLKNKHRNVASRVARGLDPARLAPHDRDVL 160
                            79*******************.556878888********************************************************* PP

                 DUF573  90 elskkiWg 97 
                            +l++++W+
  Traes_4BS_1281828D6.2 161 HLCSRLWD 168
                            *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.6E-2475168IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MASDQTLPLP PLLLPSNPNQ IPTPTPTAPH PTPSPASAAR KLPIKRRSPP RPSSSPSSSA  60
GAASSGQGQN PPFKFQRIWS ESDELRFLQG LLGCGAQGLV FPRDLNVFYD RFSESMPQPY  120
TRSQLSEKLR RLKNKHRNVA SRVARGLDPA RLAPHDRDVL HLCSRLWDPA NAATSPFAAA  180
AAPASSLGNK RRRSNPAVVP PQTLDVPAPS GDSNSHGYNG IGSSTPGATA FPDENGAEDV  240
MYLEQESGHH LYFDDGAAFV ADGNLDGITL DGIALDQAET MAVLTDVGDN GVVAGDNGVV  300
GNDAAPQNAV NNGGNSQNGN CNVLLPHSSE HRMARAVLDV FEECLREAKA DGIVNGGNAQ  360
ESELARRWRA QRIDELDVLS RRLRLIIEDA TAAGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731950.0AK373195.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3023H08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.11e-179PREDICTED: uncharacterized protein LOC100845859
TrEMBLA0A096UR000.0A0A096UR00_WHEAT; Uncharacterized protein
STRINGBRADI1G11200.11e-178(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-12DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]