PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_071700C53.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 588aa    MW: 66319.8 Da    PI: 6.8999
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_071700C53.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS327.62.4e-1002055762373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL++cAeavss+d + a++lL+r++ ++sp+gd+ qRla+yf+++L+arla+++s+ly+al  ++t    ++e ++a++l   ++ 
  Traes_4BS_071700C53.1 205 ETLLIRCAEAVSSNDVRGASKLLERIKWHSSPTGDAKQRLAHYFAQGLEARLAGTGSRLYRALMGKHTL---TVELIKAYHLHMAACC 289
                            789************************************************************999997...8*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                             +k++ l a ++I +av+g +++Hi+ ++i+ G+QWp Ll+ La+R++gpp++RiTg++ p++g   ++ +ee g+rL++ A+++gvp
  Traes_4BS_071700C53.1 290 SIKVGLLFAINTICKAVAGRRKLHIVHYGITTGFQWPDLLRLLANREGGPPQVRITGINTPRPGlrPAQIMEEAGDRLSNCARQFGVP 377
                            ***************************************************************9*99********************* PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            fef++ +a++led++ e+L+++p+E+l+Vn+ ++  +l+des++ +    rd vL+ + +++P v+v +  +  ++++ F++rf +al
  Traes_4BS_071700C53.1 378 FEFRA-IASKLEDVRAEDLHIDPDEVLVVNSLYEFRTLMDESLTFDMvsLRDMVLNNISKMRPGVFVQSLVNGPYSAAFFMTRFRHAL 464
                            *****.7**********************************987655449************************************** PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                            +y++alfd +e+++pr++++r  vEr +++r++ n++acega+r+er +++++W++r e+aG++++pl+ +++   k  ++  + + +
  Traes_4BS_071700C53.1 465 YYFTALFDVMENTVPRDNDQRLLVERDIFARSAINMIACEGADRVERPQNYKEWQARNERAGLRQLPLDPDVVLILKDQVKSRYHKHF 552
                            ************************************************************************************999* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                            ++ e++ +l++gWk+r L++ S W
  Traes_4BS_071700C53.1 553 MISEDHRWLLQGWKGRVLYAHSTW 576
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.649178557IPR005202Transcription factor GRAS
PfamPF035148.2E-98205576IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MLTEEDIVDK FFYQYPDHPE LLQAEQPFAE ILADTSSDAH ESFASSTSIL MPSQVLNGTG  60
TGTGTVEPSG LVFPIPSESS TRTDMLSSMA FFKGMEEANR FLPADNVMVA GRGRKKRWSG  120
MDAETEAGLG RSSKQITALP RSVSEEEEET TALEMLDRLV LNGYDAHPGE MQEVVRVTLE  180
DKENKAAVGR RGRRGARHTV VTDLETLLIR CAEAVSSNDV RGASKLLERI KWHSSPTGDA  240
KQRLAHYFAQ GLEARLAGTG SRLYRALMGK HTLTVELIKA YHLHMAACCS IKVGLLFAIN  300
TICKAVAGRR KLHIVHYGIT TGFQWPDLLR LLANREGGPP QVRITGINTP RPGLRPAQIM  360
EEAGDRLSNC ARQFGVPFEF RAIASKLEDV RAEDLHIDPD EVLVVNSLYE FRTLMDESLT  420
FDMVSLRDMV LNNISKMRPG VFVQSLVNGP YSAAFFMTRF RHALYYFTAL FDVMENTVPR  480
DNDQRLLVER DIFARSAINM IACEGADRVE RPQNYKEWQA RNERAGLRQL PLDPDVVLIL  540
KDQVKSRYHK HFMISEDHRW LLQGWKGRVL YAHSTWVVEW HLFVQSCC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-422085768374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750620.0AK375062.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3084L15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575611.20.0PREDICTED: scarecrow-like protein 33
TrEMBLW5E8X10.0W5E8X1_WHEAT; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-128GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]