PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_ECD20BE67.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HD-ZIP
Protein Properties Length: 316aa    MW: 35099.8 Da    PI: 4.7143
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_ECD20BE67.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1964115556
                            SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  Traes_4BL_ECD20BE67.1  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
                            467789*********************************************9 PP

2HD-ZIP_I/II128.92.1e-4162153293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++
  Traes_4BL_ECD20BE67.1  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAA 149
                            9**************************************************************************************9 PP

            HD-ZIP_I/II  90 elke 93 
                            e++e
  Traes_4BL_ECD20BE67.1 150 EIHE 153
                            9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-1860119IPR009057Homeodomain-like
SMARTSM003891.9E-1960121IPR001356Homeobox domain
PROSITE profilePS5007116.55262117IPR001356Homeobox domain
CDDcd000865.84E-1762118No hitNo description
PfamPF000468.9E-1764115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-1969116IPR009057Homeodomain-like
PRINTSPR000314.4E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000314.4E-597113IPR000047Helix-turn-helix motif
PfamPF021832.8E-16117158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MKRQIKRPTR SQESPEPGEK LAFAEKEHLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWKTKQLE  120
RDFNALRARH DALRADCDAL RRDKDALAAE IHELREKLSI KPETAVKAEA TGNVDAAEER  180
LQQATMVGAT VCKDGSSDSD SSAVFNDEAS PYSSAVFEQQ GFMGFGASFL DSASAAAATT  240
GCSSLPMLEP KWPGAYPYDA NRSGGYGFTE EWLAGSDAIV NDGSSAFFSE EHVSNLNFGW  300
CSSGAEGFDL QSYCKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539650.0AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.10.0homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-109HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A3B6IVL40.0A0A3B6IVL4_WHEAT; Uncharacterized protein
STRINGTraes_4BL_ECD20BE67.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-31homeobox 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]