PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_A37F6FD08.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CAMTA
Protein Properties Length: 990aa    MW: 110355 Da    PI: 6.0376
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_A37F6FD08.3genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1141.23.1e-4428634118
                   CG-1  34 pksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlLeeelekivlvhylevk 118
                            p sgsl+L++rk++r+frkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+een +fqrr+yw+Lee++ +ivlvhylevk
  Traes_4BL_A37F6FD08.3   2 PASGSLFLFDRKVLRFFRKDGHNWRKKKDGKTVKEAHERLKSGSIDVLHCYYAHGEENINFQRRSYWMLEEDYMHIVLVHYLEVK 86 
                            89********************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010763.3E-44186IPR005559CG-1 DNA-binding domain
PROSITE profilePS5143764.582191IPR005559CG-1 DNA-binding domain
PfamPF038594.4E-37285IPR005559CG-1 DNA-binding domain
PfamPF018336.5E-8396481IPR002909IPT domain
CDDcd001025.52E-5396483No hitNo description
Gene3DG3DSA:2.60.40.108.2E-7396483IPR013783Immunoglobulin-like fold
SuperFamilySSF812968.71E-18397482IPR014756Immunoglobulin E-set
CDDcd002041.77E-13571692No hitNo description
SuperFamilySSF484031.09E-16591695IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.5E-17594697IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029717.21600694IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500888.736633665IPR002110Ankyrin repeat
SMARTSM002480.013633662IPR002110Ankyrin repeat
SMARTSM002481500672701IPR002110Ankyrin repeat
SuperFamilySSF525402.6E-8803857IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.036806828IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.498807836IPR000048IQ motif, EF-hand binding site
PfamPF006120.0032808827IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0022829851IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.578830854IPR000048IQ motif, EF-hand binding site
PfamPF006121.9E-4832851IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 990 aa     Download sequence    Send to blast
MPASGSLFLF DRKVLRFFRK DGHNWRKKKD GKTVKEAHER LKSGSIDVLH CYYAHGEENI  60
NFQRRSYWML EEDYMHIVLV HYLEVKAGKS SSRTRGHDNM LQGAYVDSPL SHLPSQSTDG  120
ESSLSGRASE YEAESADIYS GGAGYHSISR MQQHENGGGS IIDASVVSSY SPASSVGNHQ  180
GLRATSPNTG FYSHYQDNSP VIHNESTLGI TFNGPSTQFD LSSWNEMTKL NKGIHQLPPY  240
QSHVPSEQPP FTEGPGIESF SFDEVYSNGL DIKDGGHADT DREALWQLPS ATDSTFATVD  300
SFEQNNKLLE EAINFPVLKT QSSNLSDILK DSFKKSDSFT RWMSKELAEV DDSQVKSSSG  360
LYWNSEDADN IIGASSRDQL DQFTLDPMVA QDQLFSITEY FPSWTYAGSK TRVLVTGRFL  420
TSDEVIKLKW SCMFGEVEVP ADILADGTLR CYSPSHKPGR VPFYVTCSNR LACSEVREFE  480
YRPSDSQYMD APSPHGATNK IYLQARLDEL LSLGQDEQDE FQAALSNPTK ELIDLNKKIT  540
SLMTNNDQWS ELLKFADDNQ LAPDDRQDQF VESGMKEKLH IWLLRKAGGG GKGPSVLDDE  600
GQGVLHLAAA LGYDWAIRPT ITAGVSINFR DVHGWTALHW AAFCGRERTV VALIALGAAP  660
GALTDPRPDF PSGRTPADLA SFNGHKGISG FLAEFSLTSH LQTLNLKEAM GSNASEVSGL  720
PGIGDVTGRI ASPSAGQGLQ AGSMGDSLGA VRNAAQAAAR IYQVFRVQSF QRKQAVQYED  780
DNGVISDERA MSLLSYKPSK PGQFDPMHAA ATRIQNKFRG WKGRKEFLLI RQRIVKIQAH  840
VRGHQVRKHY RKIIWSVGIV EKVILRWRRR GAGLRGFRST EGATDSSTRS SSVDVTPVKP  900
AEDDYNFLQE GRKQTEERLQ RALARVKSMV QYPEARDQYQ RILTVVTKMQ ESQPVEESML  960
EESTEMDEGF LMSEFKELWD DDMPPLPGYF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3652100.0AK365210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2032B14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558617.10.0PREDICTED: calmodulin-binding transcription activator 1-like isoform X1
TrEMBLW5E6030.0W5E603_WHEAT; Uncharacterized protein
STRINGBRADI1G71810.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]