PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_86941BB78.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 458aa    MW: 51784.3 Da    PI: 8.045
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_86941BB78.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3281.8e-100774482373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            ++lL++cAeav+s+d   a++lL+r++ ++sp+gd+ qRla+yf+++L+arla+++s++y++l  ++ts    +e + a+++   +s 
  Traes_4BL_86941BB78.1  77 ETLLVRCAEAVASNDVCGASKLLERIKYHSSPTGDARQRLAHYFAQGLEARLAGTGSRMYRSLMGKRTS---AVELIRAYHVHTAASC 161
                            789************************************************************999998...9*************** PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                             +k++ l   ++I++av+g +++Hi+ ++is G+QWp Ll+ La+R++gpp+++iTg++ p++g   +  +ee g+rL+++A+++gvp
  Traes_4BL_86941BB78.1 162 SIKVGLLFSTHTIYKAVAGRRKLHIVHYGISTGIQWPDLLRLLANREGGPPQVKITGINTPQPGpcPAALMEEAGHRLNNYASQFGVP 249
                            ****************************************************************999999****************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            fef++ +a++led++ e+L+++p+E+l+V++ ++  +l+des++++   +rd vL+++++++P v+v +  +  ++++ F++rf +al
  Traes_4BL_86941BB78.1 250 FEFRA-IASKLEDVRAEDLHIDPDEVLVVSSLYEFRTLMDESLTSDMlsPRDMVLNTIRKMRPSVFVSSVVNGPYSAAFFMTRFRHAL 336
                            *****.7**********************************99887666*************************************** PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                            +y++alfd +e+++pr+s++r  vEr +++r++ n +acega+r+er +++++W++r ++aG++++pl+ +++   k  +++ + + +
  Traes_4BL_86941BB78.1 337 YYFTALFDVMETTIPRDSDKRLLVERDIFARSAINRIACEGADRVERPQNYKEWQMRNQRAGLRQLPLDPDIVLMLKDEVKNRYHKHF 424
                            ************************************************************************************999* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                            ++ e++ +l++gWk+r L++ S W
  Traes_4BL_86941BB78.1 425 MICEDHRWLLQGWKGRVLYAHSTW 448
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.20450429IPR005202Transcription factor GRAS
PfamPF035146.2E-9877448IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MVVLHSATAL EEEEEEAEAT ALEMLDRLIL NGCEACPSEM QEVVRVTWED KEDKAARQSI  60
SRRGRRGARH TVVTDLETLL VRCAEAVASN DVCGASKLLE RIKYHSSPTG DARQRLAHYF  120
AQGLEARLAG TGSRMYRSLM GKRTSAVELI RAYHVHTAAS CSIKVGLLFS THTIYKAVAG  180
RRKLHIVHYG ISTGIQWPDL LRLLANREGG PPQVKITGIN TPQPGPCPAA LMEEAGHRLN  240
NYASQFGVPF EFRAIASKLE DVRAEDLHID PDEVLVVSSL YEFRTLMDES LTSDMLSPRD  300
MVLNTIRKMR PSVFVSSVVN GPYSAAFFMT RFRHALYYFT ALFDVMETTI PRDSDKRLLV  360
ERDIFARSAI NRIACEGADR VERPQNYKEW QMRNQRAGLR QLPLDPDIVL MLKDEVKNRY  420
HKHFMICEDH RWLLQGWKGR VLYAHSTWAA GDPTGSLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-45804488374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750620.0AK375062.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3084L15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575611.20.0PREDICTED: scarecrow-like protein 33
TrEMBLW5E5480.0W5E548_WHEAT; Uncharacterized protein
STRINGBRADI4G09155.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-124SCARECROW-like 14
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]