PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_FF199F127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 477aa    MW: 53869.6 Da    PI: 7.1958
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_FF199F127.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3312.2e-101924671373
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++ L++cA+av++gd++  ++lL ++++++sp+gd++qRla +f+e+L+arla+++s++y++l +++ts   + e l a+kl+  +s
  Traes_4AL_FF199F127.1  92 LRTMLIHCAQAVATGDHRGSNELLRQIKQHSSPKGDATQRLAYCFAEGLEARLAGTGSHVYRSLVAKSTS---VGEFLRAYKLYMAAS 176
                            5789***************************************************************999...9************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                             + k+ ++   + I++a+ g++r+Hi+D+++++G+QWp Llq La+R++gpp++RiTg++ p++g   + ++eetg+rL+k A+e+gv
  Traes_4AL_FF199F127.1 177 SFRKVNFIFVGKIIMDAMVGKSRLHIVDYNVEYGFQWPDLLQMLAEREGGPPEVRITGIDVPQPGfrPAFQIEETGRRLSKCAQEFGV 264
                            ****************************************************************999********************* PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                            pf+++  +  +le+++ e+L+++p+E+l+V ++    +l+desv ++      +rd vL  +++++P+v++ +  +  ++++ F++rf
  Traes_4AL_FF199F127.1 265 PFRYHG-IPAKLETVHAEDLNIDPNEVLIVTSQCGFSNLMDESVIMDRqdipsPRDMVLTNIRNMRPDVFIDCVVNGTYSAPFFVTRF 351
                            ******.799******************************99887665555669********************************** PP

                   GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             eal +ysa fd+l+a++pr++++r  +Er ++g+ + nv+ace a+r+ r et+++W+ r ++aG+++vpls+ ++k +k  ++  +
  Traes_4AL_FF199F127.1 352 REALFTYSAQFDMLDATIPRDNDDRLLIERDIFGPCALNVIACEDADRVDRPETYKQWQVRGHRAGLRQVPLSSAVVKLVKDKVKSLY 439
                            **************************************************************************************** PP

                   GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                             + + ++ ++ +l++gWk+r L+++S W
  Traes_4AL_FF199F127.1 440 HKDFLIDVDNRWLLQGWKGRVLYAMSTW 467
                            888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.41666448IPR005202Transcription factor GRAS
PfamPF035147.6E-9992467IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MLMFSNGRGR KNRHGVEDLE AEAGRRSKLM MPEQEESGVG EMVEEIMLHG HDIIMKGIED  60
LQIAMGTEAE KNHRKGTGKA ARGRRGATEV DLRTMLIHCA QAVATGDHRG SNELLRQIKQ  120
HSSPKGDATQ RLAYCFAEGL EARLAGTGSH VYRSLVAKST SVGEFLRAYK LYMAASSFRK  180
VNFIFVGKII MDAMVGKSRL HIVDYNVEYG FQWPDLLQML AEREGGPPEV RITGIDVPQP  240
GFRPAFQIEE TGRRLSKCAQ EFGVPFRYHG IPAKLETVHA EDLNIDPNEV LIVTSQCGFS  300
NLMDESVIMD RQDIPSPRDM VLTNIRNMRP DVFIDCVVNG TYSAPFFVTR FREALFTYSA  360
QFDMLDATIP RDNDDRLLIE RDIFGPCALN VIACEDADRV DRPETYKQWQ VRGHRAGLRQ  420
VPLSSAVVKL VKDKVKSLYH KDFLIDVDNR WLLQGWKGRV LYAMSTWVAG DHDISKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-39964678374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3649830.0AK364983.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758864.10.0PREDICTED: scarecrow-like protein 34
TrEMBLW5DVP50.0W5DVP5_WHEAT; Uncharacterized protein
STRINGMLOC_74705.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-138GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]