PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_FB3CE240C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 191aa    MW: 20237.7 Da    PI: 5.0031
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_FB3CE240C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS129.15.1e-40621912128
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfse 86 
                            v +L++cAea++  ++ +a+ +Larl e+asp+g +p++R+aa+f+eALa r a++++++++  pp+e ++     ++ + al++++ 
  Traes_4AL_FB3CE240C.1  62 VGALTACAEALAGCQHDAANYYLARLGETASPSGpTPLHRVAACFAEALALRAANMWPHVFDVTPPRELTDGAfhDDDDALALRVLNS 149
                            678******************************************************************988887888999999**** PP

                   GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaL 128
                            v+Pi++f h+t N+ +l+a++g++rvHiiDfdi+qGlQWp+L
  Traes_4AL_FB3CE240C.1 150 VTPIPRFLHFTLNERLLRAFDGHDRVHIIDFDIKQGLQWPSL 191
                            ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.96135191IPR005202Transcription factor GRAS
PfamPF035141.8E-3762191IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAAAAGPSSL AAAKQEEFSK SPSHSSSSSG TDGGSSAVLP VEPAGVRGFV VPEAEREALE  60
LVGALTACAE ALAGCQHDAA NYYLARLGET ASPSGPTPLH RVAACFAEAL ALRAANMWPH  120
VFDVTPPREL TDGAFHDDDD ALALRVLNSV TPIPRFLHFT LNERLLRAFD GHDRVHIIDF  180
DIKQGLQWPS L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964401.12e-79PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN36e-47SCL28_ARATH; Scarecrow-like protein 28
TrEMBLW5DVK51e-137W5DVK5_WHEAT; Uncharacterized protein
STRINGMLOC_31327.11e-114(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.12e-40GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]