PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_FB3CE240C.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 191aa    MW: 20237.7 Da    PI: 5.0031
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_FB3CE240C.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS129.15.1e-40621912128
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalklfse 86 
                            v +L++cAea++  ++ +a+ +Larl e+asp+g +p++R+aa+f+eALa r a++++++++  pp+e ++     ++ + al++++ 
  Traes_4AL_FB3CE240C.1  62 VGALTACAEALAGCQHDAANYYLARLGETASPSGpTPLHRVAACFAEALALRAANMWPHVFDVTPPRELTDGAfhDDDDALALRVLNS 149
                            678******************************************************************988887888999999**** PP

                   GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaL 128
                            v+Pi++f h+t N+ +l+a++g++rvHiiDfdi+qGlQWp+L
  Traes_4AL_FB3CE240C.1 150 VTPIPRFLHFTLNERLLRAFDGHDRVHIIDFDIKQGLQWPSL 191
                            ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098524.96135191IPR005202Transcription factor GRAS
PfamPF035141.8E-3762191IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAAAAGPSSL AAAKQEEFSK SPSHSSSSSG TDGGSSAVLP VEPAGVRGFV VPEAEREALE  60
LVGALTACAE ALAGCQHDAA NYYLARLGET ASPSGPTPLH RVAACFAEAL ALRAANMWPH  120
VFDVTPPREL TDGAFHDDDD ALALRVLNSV TPIPRFLHFT LNERLLRAFD GHDRVHIIDF  180
DIKQGLQWPS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-206819126146Protein SCARECROW
5b3h_A3e-206819125145Protein SCARECROW
5b3h_D3e-206819125145Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as positivie regulator of brassinosteroid (BR) signaling (PubMed:19220793, PubMed:22685166). Functions downstream of BRI1 and GSK2 to modulate BR responses. Acts as a direct target of GSK2 kinase to mediate BR responses (PubMed:22685166). Involved in feedback inhibition of BR biosynthetic genes. Repressed by BZR1 (PubMed:19220793). {ECO:0000269|PubMed:19220793, ECO:0000269|PubMed:22685166}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by 24-epibrassinolide. {ECO:0000269|PubMed:19220793}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020158067.11e-130scarecrow-like protein 28
SwissprotQ9LWU93e-65DLT_ORYSJ; Protein DWARF AND LOW-TILLERING
TrEMBLA0A3B6I5W41e-130A0A3B6I5W4_WHEAT; Uncharacterized protein
STRINGTraes_4AL_FB3CE240C.11e-136(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.12e-40GRAS family protein
Publications ? help Back to Top
  1. Tong H,Chu C
    Roles of DLT in fine modulation on brassinosteroid response in rice.
    Plant Signal Behav, 2009. 4(5): p. 438-9
    [PMID:19816111]
  2. Li W, et al.
    Identification and characterization of dwarf 62, a loss-of-function mutation in DLT/OsGRAS-32 affecting gibberellin metabolism in rice.
    Planta, 2010. 232(6): p. 1383-96
    [PMID:20830595]
  3. Tong H, et al.
    DWARF AND LOW-TILLERING acts as a direct downstream target of a GSK3/SHAGGY-like kinase to mediate brassinosteroid responses in rice.
    Plant Cell, 2012. 24(6): p. 2562-77
    [PMID:22685166]
  4. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  5. Zhang C,Bai MY,Chong K
    Brassinosteroid-mediated regulation of agronomic traits in rice.
    Plant Cell Rep., 2014. 33(5): p. 683-96
    [PMID:24667992]
  6. Yang C,Shen W,He Y,Tian Z,Li J
    OVATE Family Protein 8 Positively Mediates Brassinosteroid Signaling through Interacting with the GSK3-like Kinase in Rice.
    PLoS Genet., 2016. 12(6): p. e1006118
    [PMID:27332964]