PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_F023A8691.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 573aa    MW: 64609.2 Da    PI: 5.8592
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_F023A8691.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3182.1e-971955642373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                             +lL++cA+av + d + a +lL++++++asp+gd++q la  f+e+L+arl++++s++y  l+++ ts   ++++++a++lf  ++ 
  Traes_4AL_F023A8691.1 195 HTLLIHCAKAVMD-DRRSAGELLKEIKQHASPTGDATQWLAYWFAEGLEARLTSTGSQVYGLLTAECTS---TVRHMQAYQLFMSTCC 278
                            679********97.8999******************************************999998888...899************* PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + k+++l aN+aI +a+ g +r+Hi+D+++  G+QWp Ll+ LasR++gpp++RiT ++ p +g   ++ +e++g+rL+++A+elgvp
  Traes_4AL_F023A8691.1 279 FRKVAFLFANKAIFNAAVGRSRLHIVDYGLHCGFQWPELLRWLASRDGGPPEVRITHIELPLPGvyPEKHMEQIGNRLTDIAQELGVP 366
                            *************************************************************99999********************** PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            f++++ ++ +++++ +e+L+ +p+EalaVn +++  +l+desv ++s  +rd+vL  + +++P+v+v +  + ++ ++ Fl rf eal
  Traes_4AL_F023A8691.1 367 FKYRA-IMAQWQTICVEDLDKEPDEALAVNDQFNFRTLMDESVVIASpnPRDAVLGNISKMKPDVFVQSTVNGSY-GTFFLSRFREAL 452
                            *****.6999*********************************9998889***********************99.789********* PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                             y+salfd+l+a++pres+ r  +Er ++g+ + n+va eg++r+er et+++W+ r ++aG++++pl+ +++k a  ++   + + +
  Traes_4AL_F023A8691.1 453 FYHSALFDMLDATMPRESKLRLALERDVFGWMVLNAVAYEGEDRVERGETYKHWQIRNQRAGLRQLPLNRETVKMATDMVMGDYHKDF 540
                            *************************************************************************99998888877677* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             ++e++++l++gWk+r L++ S W
  Traes_4AL_F023A8691.1 541 DIDEDHQWLLQGWKGRILYAHSTW 564
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.713168545IPR005202Transcription factor GRAS
PfamPF035147.1E-95195564IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MADDDSNCFA VQDHLALPYI TQILMEEEDD VDEDSPALLK AQRPFAQILS SSMHASTLMA  60
DQGGALAIDV HSPSSPIFKF NGVDEVHSLM LLPDADYSTH MFSIAFLRGM EEANKFLPRN  120
CELTTTGGHD QPKEKSGRGR KDRHGEVEAD VSRTSRLVEV GAGEVFDQML IAHGNETGNS  180
NKKGRKSKTR VVDLHTLLIH CAKAVMDDRR SAGELLKEIK QHASPTGDAT QWLAYWFAEG  240
LEARLTSTGS QVYGLLTAEC TSTVRHMQAY QLFMSTCCFR KVAFLFANKA IFNAAVGRSR  300
LHIVDYGLHC GFQWPELLRW LASRDGGPPE VRITHIELPL PGVYPEKHME QIGNRLTDIA  360
QELGVPFKYR AIMAQWQTIC VEDLDKEPDE ALAVNDQFNF RTLMDESVVI ASPNPRDAVL  420
GNISKMKPDV FVQSTVNGSY GTFFLSRFRE ALFYHSALFD MLDATMPRES KLRLALERDV  480
FGWMVLNAVA YEGEDRVERG ETYKHWQIRN QRAGLRQLPL NRETVKMATD MVMGDYHKDF  540
DIDEDHQWLL QGWKGRILYA HSTWVAEGAS SHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-421985648374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758581.10.0PREDICTED: scarecrow-like protein 14
TrEMBLW5DV400.0W5DV40_WHEAT; Uncharacterized protein
STRINGMLOC_43730.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-125SCARECROW-like 14
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]