PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_E769BB5A6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 574aa    MW: 63991.9 Da    PI: 6.3884
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_E769BB5A6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.26.4e-932535701318
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                            l++lLl+cA+a+s+++ + a++lL+r++++++p+gd+ qRla+yf+eAL arla+ +sely++l +++ts   +++ l+a +l+  ++
  Traes_4AL_E769BB5A6.1 253 LRTLLLNCAQALSTDNRRTASELLKRIRQHSTPKGDAAQRLAHYFAEALDARLAGRGSELYQSLMARRTS---VADFLKANQLYMAAC 337
                            6789**************************************************************9999...*************** PP

                   GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgv 174
                             + k++++ aN++I +av g++r+Hi+D+++sqGlQWp Ll  La+R++gpp+++iTg++ p++g   +  +eetg+rL++fA+ +gv
  Traes_4AL_E769BB5A6.1 338 CCKKVAFIFANKTICNAVVGKSRLHIVDYGLSQGLQWPGLLCMLAAREGGPPEVKITGIDLPQPGfqGAYHIEETGRRLSNFARVFGV 425
                            ****************************************************************9989999***************** PP

                   GRAS 175 pfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                            pf+f+  +a + e++++e+L+++++E+l+V +  +   l+de++ l+   +rd+vL+ +++++P+v+++   + +++++ Fl+rf ea
  Traes_4AL_E769BB5A6.1 426 PFKFHG-IAAKRETVQPEDLSIDRDEVLVVISLCHFRLLMDENLGLDTpsPRDQVLNNIRKMRPDVFIHGIMNGSYGATYFLTRFREA 512
                            ******.69999**********************99999999987665559************************************* PP

                   GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrer 318
                            l  ysa fd l+a++pr++e r  +Er ++gr++ nv+aceg++r+er et+++W+ r
  Traes_4AL_E769BB5A6.1 513 LFNYSAQFDLLDATVPRDNEGRLLLERDIFGRSALNVIACEGSDRVERPETYKQWQLR 570
                            *******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.893227574IPR005202Transcription factor GRAS
PfamPF035142.2E-90253570IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MAATPEEFLG QQSFLSRLEP PSPSLFLGLP PTPRGVEDGD SSFDDMALPY ISRLLEEDME  60
DHFFYLYPNH PALLRAQLPF AQILVDVADS ASGSTSALSP SFSTSTFDAT ASTTPSATSP  120
YDAANYLLPG DQDMLNLAFL KGMEEARKFL PPNSSLPAMK VDQVVAGVHA GAGLKKKRDT  180
LEPDMGRASK LMMPEQEEDG ARELFDEMMF QEHEICMKGV QQLRVAVDSE PGKNRRKKGR  240
PRRDSSDSEM VDLRTLLLNC AQALSTDNRR TASELLKRIR QHSTPKGDAA QRLAHYFAEA  300
LDARLAGRGS ELYQSLMARR TSVADFLKAN QLYMAACCCK KVAFIFANKT ICNAVVGKSR  360
LHIVDYGLSQ GLQWPGLLCM LAAREGGPPE VKITGIDLPQ PGFQGAYHIE ETGRRLSNFA  420
RVFGVPFKFH GIAAKRETVQ PEDLSIDRDE VLVVISLCHF RLLMDENLGL DTPSPRDQVL  480
NNIRKMRPDV FIHGIMNGSY GATYFLTRFR EALFNYSAQF DLLDATVPRD NEGRLLLERD  540
IFGRSALNVI ACEGSDRVER PETYKQWQLR NHRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-392575688315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3664420.0AK366442.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2043B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014758580.10.0PREDICTED: scarecrow-like protein 9 isoform X2
RefseqXP_003575618.10.0PREDICTED: scarecrow-like protein 9 isoform X2
TrEMBLW5DUS60.0W5DUS6_WHEAT; Uncharacterized protein
STRINGBRADI4G09180.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-120GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]