PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_096D26391.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CPP
Protein Properties Length: 788aa    MW: 85106.1 Da    PI: 7.0334
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_096D26391.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.44.5e-16476514240
                    TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Traes_4AL_096D26391.2 476 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 514
                            689**********************************96 PP

2TCR49.21e-15562601140
                    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                            ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  Traes_4AL_096D26391.2 562 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 601
                            589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-17475516IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.117476602IPR005172CRC domain
PfamPF036388.9E-12478513IPR005172CRC domain
SMARTSM011141.6E-15562603IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-11564600IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MDTPDRAAAP AAARAEDSPL FSFIDSLSPI EPLKSAYSGN GLQAYHQSLN VTSVSSIFTS  60
PHHNAHKESK LSKGSFADYT ENELCMEEGT DKNKSPTSST AVRLFACTST ITRESHTMTT  120
CSVNEGIVDP PKGPNDLPQP GRFDSGSPDH NTAPCHGVSV RSDLKQDKCP KLEAVQTTNN  180
TVEKRKCLFS TDMQLQDGCQ PAKENNEVMG CEWDDLVSVT SGELLAFDSS MDQHHTGVQL  240
AVNNAESCGY LLSKLAGGAD ISDRTHPTTS SQAYYHEMVV GEDKTENGQL FPEDKKTILS  300
EEIQDNINEE NACIPLGCKV ETQQRGVRRR CLVFEAAGYS HRTVQKESAG DLSFSTCKGK  360
SSAQNHRNPG KTPSPHVFRG IGLHLNALAL TSKDKMACQD PLATALVPSL KTEQVVHGNL  420
LSAGGNFFHS GSGSLDLQMD NDDCSVGGFL GNDHNSSQSS SPPKKRRKSD NGDDDSCKRC  480
SCKKSKCLKL YCECFAAGVY CSEPCSCQGC LNKPIHEEIV LSTRKQIEFR NPLAFAPKVI  540
RMSEAGQETQ QEDPKNTPAS ARHKRGCNCK KSSCLKKYCE CYQGGVGCSN NCRCETCKNT  600
FGTRDVAVSA ENEEMKQEGE QTESCEKEKE NDQQKANVHS EDHKLVELVV PITPPLDVSS  660
SLLKQPNFSN AKPPRPCKAR SGSSSRSSKA SVTVQSRKIS KVGDSVFIEE MPDILREPSS  720
PGIVKTCSPN GKRVSPPHNA LSISPNRKGG RKLILKSIPS FPSLVGDTNG GSAICSSDST  780
TALALGPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1547859912120Protein lin-54 homolog
5fd3_B8e-1547859912120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1462468PKKRRKS
2463467KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A3B6I0C90.0A0A3B6I0C9_WHEAT; Uncharacterized protein
TrEMBLA0A446R9U80.0A0A446R9U8_TRITD; Uncharacterized protein
STRINGTraes_4AL_096D26391.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-80TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]