PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_04B7D5758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 649aa    MW: 72707.8 Da    PI: 5.2003
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_04B7D5758.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS315.71e-962706402373
                   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                            + lLl cA+ v++g+ + a +lL++++++as +gd+ qRla +f+++L+arla+++s++yk+l +++ts   + e l+ ++lf  ++ 
  Traes_4AL_04B7D5758.1 270 RGLLLCCAQEVATGNRHGAGNLLKQIRQHASATGDAAQRLAYCFAKGLEARLAGTGSQVYKSLMAKHTS---TMEFLKGYELFMAACS 354
                            679*************************************************************99999...899************* PP

                   GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvp 175
                            + ++++     +I +aveg++++Hi+D+++ +G QWp Ll  La+R++gpp++RiTg++ p++g   +++leetg+ L++ A+++g+p
  Traes_4AL_04B7D5758.1 355 FKRVAFTFSSMTIFDAVEGKSKLHIVDYGLHYGCQWPGLLAWLATRDGGPPEVRITGIDLPQPGfrPAKRLEETGRALSNCARQFGLP 442
                            ***************************************************************9************************ PP

                   GRAS 176 fefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                            f+f++ +a ++e+++ e+L+++p+E+l+Vn  ++  +l+des+ ++   +rd vL+ +++++P+v+v    + +  ++ Fl+rf eal
  Traes_4AL_04B7D5758.1 443 FKFHA-IAAKWETIRAEDLNIDPDEVLVVNDLFNFNTLMDESLVIDRpsPRDVVLSNIREMQPDVFVQGVVNGSS-GPFFLARFREAL 528
                            *****.799*********************************98877669****************999888776.89********** PP

                   GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                             +ys++fd+l+++ p+es er ++Er ++g+ + n +ace a+r+er et+++W+ r ++a ++++pl+  ++k a   ++  + +++
  Traes_4AL_04B7D5758.1 529 FFYSSVFDMLDTTTPPESYERFVLERDMFGQCALNTIACESADRVERPETYKQWQLRNQRASLRQLPLKPIITKVATGKVKSLYHKEF 616
                            ************************************************************************************999* PP

                   GRAS 350 rveeesgslvlgWkdrpLvsvSaW 373
                             v+ ++g+l++gWk+r L++ SaW
  Traes_4AL_04B7D5758.1 617 VVDVDQGWLLQGWKGRILYAHSAW 640
                            ************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.748243621IPR005202Transcription factor GRAS
PfamPF035143.5E-94270640IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MPIAPEELLG LKEHMEPPPP SPSVYLDIPP SPYGGSVGDL VLPYITRMLM EEDIDDRFFY  60
QYPDHLAFLQ AQQQFTQILD DAKNLLSGEG GDMEKMHSDA SLQGIRGGSM CLADKDVPSW  120
TFSDGAEVYN NGDQSKLNRS NEAMLNFAFL KGMEEANKFL PRDNQPQADV FSVDQAKEIF  180
GRSISGGGRK GQRDVDKLEE VVGRASKLLM PELEEDGASE MINKIMLNSY ELCGETMEEL  240
QITMENIRAD RKNKKAVRGK QGKKEAVDLR GLLLCCAQEV ATGNRHGAGN LLKQIRQHAS  300
ATGDAAQRLA YCFAKGLEAR LAGTGSQVYK SLMAKHTSTM EFLKGYELFM AACSFKRVAF  360
TFSSMTIFDA VEGKSKLHIV DYGLHYGCQW PGLLAWLATR DGGPPEVRIT GIDLPQPGFR  420
PAKRLEETGR ALSNCARQFG LPFKFHAIAA KWETIRAEDL NIDPDEVLVV NDLFNFNTLM  480
DESLVIDRPS PRDVVLSNIR EMQPDVFVQG VVNGSSGPFF LARFREALFF YSSVFDMLDT  540
TTPPESYERF VLERDMFGQC ALNTIACESA DRVERPETYK QWQLRNQRAS LRQLPLKPII  600
TKVATGKVKS LYHKEFVVDV DQGWLLQGWK GRILYAHSAW VADDTSSEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-392736408374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575617.30.0PREDICTED: scarecrow-like protein 9
TrEMBLW5DL690.0W5DL69_WHEAT; Uncharacterized protein
STRINGBRADI4G09170.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-140GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]