PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DS_CC9498D91.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family B3
Protein Properties Length: 78aa    MW: 8893.04 Da    PI: 9.8212
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DS_CC9498D91.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.44.7e-226613287
                           --SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                     B3 32 esktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                           +++ l +ed +g++W+++++y+++s++yvltkGW++Fv+++gL +gD++vF+ +  
  Traes_3DS_CC9498D91.1  6 KGVLLNFEDGEGKVWRFRYSYWNSSQSYVLTKGWSRFVREKGLGAGDSIVFSCSAY 61
                           678899*********************************************96543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.647175IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-23474IPR015300DNA-binding pseudobarrel domain
PfamPF023627.1E-20565IPR003340B3 DNA binding domain
SuperFamilySSF1019361.15E-19672IPR015300DNA-binding pseudobarrel domain
CDDcd100175.30E-161256No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
TTTTGKGVLL NFEDGEGKVW RFRYSYWNSS QSYVLTKGWS RFVREKGLGA GDSIVFSCSA  60
YGQEKQFFID CKKNKTMA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A4e-2816945112DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3720821e-103AK372082.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2146E06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020201133.18e-51AP2/ERF and B3 domain-containing protein Os01g0141000-like
RefseqXP_020201484.18e-51AP2/ERF and B3 domain-containing protein Os01g0141000-like
SwissprotQ9AWS04e-40Y1410_ORYSJ; AP2/ERF and B3 domain-containing protein Os01g0141000
TrEMBLA0A453DVL15e-51A0A453DVL1_AEGTS; Uncharacterized protein
STRINGTraes_3B_90BE2090B.19e-52(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5930622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68840.22e-29related to ABI3/VP1 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]