PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_68BC65ED4.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 235aa    MW: 26968 Da    PI: 8.8343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_68BC65ED4.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-0794184347
                            SS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrw 44 
                            +W+  E ++l++++kq   +                                              +W+ Ia++   gR++ +c srw
  Traes_3DL_68BC65ED4.1  94 SWSDTEKDRLAKGIKQQYQEmlikdsmkngsssgdfsavdmayaltntggnfeatheilrsvlplvNWDYIAAMYLPGRSGAECESRW 181
                            699999999999999999889999999999999999999999999999999*********************99888*********** PP

                            HHH CS
        Myb_DNA-binding  45 qky 47 
                            ++y
  Traes_3DL_68BC65ED4.1 182 LNY 184
                            *98 PP

2Myb_DNA-binding23.41.4e-07192235245
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q
  Traes_3DL_68BC65ED4.1 192 NAWTACEEKRLILTVQERGMHNWINIAVALGTQRTPFQCFARYQ 235
                            68*****************************99******99998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.29587185IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-1194110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-11157192IPR009057Homeodomain-like
SuperFamilySSF466891.51E-16166235IPR009057Homeodomain-like
PROSITE profilePS512949.134186235IPR017930Myb domain
PfamPF002494.3E-6192235IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-9193234IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MINIEAKIEV NKDLRDRVKC LMDYQLSCRR SFSNFLCQKV DPRVRLISSE KQSAQSAKNK  60
CKMSPLLLGP AENPHIEKYK VVLKQFPISL QKHSWSDTEK DRLAKGIKQQ YQEMLIKDSM  120
KNGSSSGDFS AVDMAYALTN TGGNFEATHE ILRSVLPLVN WDYIAAMYLP GRSGAECESR  180
WLNYDDPLIN HNAWTACEEK RLILTVQERG MHNWINIAVA LGTQRTPFQC FARYQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228416.11e-135PREDICTED: snRNA-activating protein complex subunit 4 isoform X4
RefseqXP_014752713.11e-135PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLW5DAM21e-179W5DAM2_WHEAT; Uncharacterized protein
STRINGMLOC_5739.11e-149(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.23e-65myb domain protein 4r1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]