PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_0D1B2D925.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family ZF-HD
Protein Properties Length: 96aa    MW: 10633.8 Da    PI: 6.6571
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_0D1B2D925.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer88.47.1e-282278360
            ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                            vrY+eC++NhA+ +G +avDGC+Ef+   g + +aa l CaACgCHRnFHRrev++e
  Traes_3AL_0D1B2D925.1 22 YVRYRECQRNHAIGIGRYAVDGCQEFTVLMGVD-EAAMLLCAACGCHRNFHRREVVNE 78
                           589*************************97776.9999****************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047707.7E-262375IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-142386IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.7E-232475IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152321.3032574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MGSRQDQPAV NGEQGDGAGA AYVRYRECQR NHAIGIGRYA VDGCQEFTVL MGVDEAAMLL  60
CAACGCHRNF HRREVVNEFG VDYHAPRTPP ADEHRR
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-133HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180776.11e-64mini zinc finger protein 3-like
SwissprotQ2Q4933e-19MIF3_ARATH; Mini zinc finger protein 3
TrEMBLA0A446P2411e-64A0A446P241_TRITD; Uncharacterized protein
TrEMBLW5CAI31e-64W5CAI3_WHEAT; Uncharacterized protein
STRINGTraes_3AL_0D1B2D925.12e-65(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18835.11e-21mini zinc finger
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]