PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_46E59998A1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 631aa    MW: 66265.7 Da    PI: 6.7939
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_46E59998A1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS296.28.6e-912646312374
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL e+A a+++g+le a a La+l+  a+p+gd+ qRl+a+++ AL++r+a       ++ ++++ ++   +e+ +  +l+++++
  Traes_2BL_46E59998A1.1 264 RQLLSEAAAAIADGNLETAAANLATLKRAANPRGDAEQRLVAVMVAALSSRIAP-----TASASSQQLADLCGAEHHTGSQLLHDIT 345
                             689**************************************************9.....444555666655689999999******* PP

                    GRAS  89 PilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAee 171
                             P+++++  +aN aI+eav+g++ +H +Dfdi+ + Q +aL+q La+R+ +   l++T+v +p+s      + +l  +gerL+k+Ae 
  Traes_2BL_46E59998A1.1 346 PCFRLALDAANIAIVEAVAGHRVIHLVDFDINAP-QHAALIQRLADRRVPGTCLQVTAVTDPTSPftqsLAATLPGVGERLKKLAEL 431
                             *******************************987.99************************9988777667788899********** PP

                    GRAS 172 lgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfl 258
                              g++ +f++ ++ r  ++e ++L ++pgEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv++veqe++ n++++++rf+
  Traes_2BL_46E59998A1.1 432 AGIEYHFRM-ISCRAVEIEASKLGCEPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVTLVEQELNSNTAPLATRFS 517
                             *********.577889999******************************************************************** PP

                    GRAS 259 ealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                             +a  +y a++d+l+++++r+s +r+  E++ +++   n+v  ega+r er+e ++kWr+r+++aGF+pv+l   +a+q+ +     +
  Traes_2BL_46E59998A1.1 518 DAYLHYGAILDALDSTVSRDSADRARAEEA-VANMSANAVGREGADRLERCEVFGKWRARFGMAGFRPVALAAGIADQVMARAGAPP 603
                             ******************************.778889******************************************99998888 PP

                    GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                               g  v+ e+g l lgWk+r + ++SaWr
  Traes_2BL_46E59998A1.1 604 -PGLVVKPENGVLRLGWKQRVVAVASAWR 631
                             .9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.381237612IPR005202Transcription factor GRAS
PfamPF035143.0E-88264631IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MEPGGPWRDP RQGYIYGLGS PMQMPAQQRS DPAAAGGVLK RSLGELERWQ HQRQFAMQQE  60
LYLRAVRQRT AATSPAVSPL TSADIAAVLG GVPAQPFFSG SSLGGGLASP SSTLSSLTTA  120
SRAAMPLIQH HVHRQTPLVP SSAHAQTQAQ AHALAVARVP APSAVGSELS ILQDLEKQLL  180
GDDDEAEPAM SGTGSTVTSS EWEETIQRLN SITAASSPPL YAEATPNNKN NYSAAMTGSP  240
SNSSTSTASS SASCSPPISA TTSRQLLSEA AAAIADGNLE TAAANLATLK RAANPRGDAE  300
QRLVAVMVAA LSSRIAPTAS ASSQQLADLC GAEHHTGSQL LHDITPCFRL ALDAANIAIV  360
EAVAGHRVIH LVDFDINAPQ HAALIQRLAD RRVPGTCLQV TAVTDPTSPF TQSLAATLPG  420
VGERLKKLAE LAGIEYHFRM ISCRAVEIEA SKLGCEPGEA LAVNLAFALS HVPDESVSPA  480
NPRDELLRRV RALGPQVVTL VEQELNSNTA PLATRFSDAY LHYGAILDAL DSTVSRDSAD  540
RARAEEAVAN MSANAVGREG ADRLERCEVF GKWRARFGMA GFRPVALAAG IADQVMARAG  600
APPPGLVVKP ENGVLRLGWK QRVVAVASAW R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402596311375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580377.10.0PREDICTED: scarecrow-like protein 8
TrEMBLW5B9E80.0W5B9E8_WHEAT; Uncharacterized protein
STRINGMLOC_72117.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.12e-81SCARECROW-like 8
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]