PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AL_83D0D0C3F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family LFY
Protein Properties Length: 396aa    MW: 43097.9 Da    PI: 8.9308
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AL_83D0D0C3F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY534.15.3e-16313801385
                FLO_LFY   1 mdpea..fsaslfkwd...praaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkd 83 
                            mdp++  ++a+ f+wd   p+      pa + +    +++     a   a++ rele+l+ +yGvr +tva+i+elGft+stL+ m++
  Traes_2AL_83D0D0C3F.1   1 MDPNDafLAAHPFRWDlgpPA------PAAVPPPPPPPPP---PPALPPANAPRELEDLVVGYGVRASTVARISELGFTASTLLVMTE 79 
                            777665346779****44322......2223222222222...2345566779*********************************** PP

                FLO_LFY  84 eelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqeekeaagsggeglgea 171
                            +eldd++++l+ +fr+dll+Ger+G++aa+raer rl++      r++    ++ +++d +sqeg      ++e++ a+sgg g+ +a
  Traes_2AL_83D0D0C3F.1  80 RELDDMTAALAGLFRWDLLIGERFGLRAALRAERGRLMSPG---CRHH--GYQSGSTIDGASQEGDYPL-LSNERDGAASGGIGEDDA 161
                            **************************************955...5555..5677889********6554.445677888888876666 PP

                FLO_LFY 172 elvaaeekkseeekkkaskkkqkrkkkkelkse.....ededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfd 254
                              ++a+ kk+++ +  +++kk++r+k kel+ +     +++    ++++ e+++g  g erqrehPf+vtepgevar+kknGLDYLf+
  Traes_2AL_83D0D0C3F.1 162 MRMMASGKKQKNGSAARKAKKARRNKVKELRLDtqgdeHEDGGGGRSESTESSAGGVGGERQREHPFVVTEPGEVARAKKNGLDYLFH 249
                            66655555544444444455777777777766644332222223345666667888899***************************** PP

                FLO_LFY 255 LyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacyk 342
                            LyeqCr fLlqvq++ak +G+k+Ptkvtnqvfrya k+gasyinkPkmrhYvhCYalhcLde+as+alrra+k+rgenvGawrqacy+
  Traes_2AL_83D0D0C3F.1 250 LYEQCRLFLLQVQSMAKLHGQKSPTKVTNQVFRYASKVGASYINKPKMRHYVHCYALHCLDEDASDALRRAYKARGENVGAWRQACYA 337
                            **************************************************************************************** PP

                FLO_LFY 343 plvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                            plv+iaar+g+didavf+ahprL+iWYvPt+LrqLCh++rs++
  Traes_2AL_83D0D0C3F.1 338 PLVDIAARHGFDIDAVFAAHPRLAIWYVPTRLRQLCHQARSAH 380
                            ****************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.4E-1881380IPR002910Floricaula/leafy protein
SuperFamilySSF1014477.32E-62636No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDPNDAFLAA HPFRWDLGPP APAAVPPPPP PPPPPPALPP ANAPRELEDL VVGYGVRAST  60
VARISELGFT ASTLLVMTER ELDDMTAALA GLFRWDLLIG ERFGLRAALR AERGRLMSPG  120
CRHHGYQSGS TIDGASQEGD YPLLSNERDG AASGGIGEDD AMRMMASGKK QKNGSAARKA  180
KKARRNKVKE LRLDTQGDEH EDGGGGRSES TESSAGGVGG ERQREHPFVV TEPGEVARAK  240
KNGLDYLFHL YEQCRLFLLQ VQSMAKLHGQ KSPTKVTNQV FRYASKVGAS YINKPKMRHY  300
VHCYALHCLD EDASDALRRA YKARGENVGA WRQACYAPLV DIAARHGFDI DAVFAAHPRL  360
AIWYVPTRLR QLCHQARSAH DAAAAAHAGA MPPPMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A9e-992183781161PROTEIN LEAFY
2vy2_A9e-992183781161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor (By similarity). Together with APO1, involved in the temporal regulation of meristem size and identity during both vegetative and reproductive developments through interaction with APO1 (PubMed:21910771). Promotes flowering (PubMed:21910771). {ECO:0000250|UniProtKB:Q00958, ECO:0000269|PubMed:21910771}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2318890.0AB231889.1 Triticum aestivum WFLb mRNA for FLORICAULA/LFAFY-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020152169.10.0probable transcription factor FL
SwissprotQ0JAI10.0FL_ORYSJ; Probable transcription factor FL
TrEMBLA0A446LFF40.0A0A446LFF4_TRITD; Uncharacterized protein
STRINGTraes_2AL_83D0D0C3F.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.12e-96floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]