PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF097200010CFD_t1
Common NameTRAES_3BF097200010CFD_c1, TRAES_3BF098000010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 404aa    MW: 43857.1 Da    PI: 6.8569
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF097200010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.13.7e-49451702128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg
  TRAES3BF097200010CFD_t1  45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATG 129
                              79***************************.89***************7777899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  TRAES3BF097200010CFD_t1 130 ADRMIRGENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170
                              ***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5544205IPR003441NAC domain
PROSITE profilePS5100554.25544205IPR003441NAC domain
PfamPF023651.6E-2446170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MSRDIDEGSV SAATAGGEGG EVGDEPVAGV SDEAAVDSHE NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGRR FNVELITFLD LYRFDPWELP AMAVIGEKEW FFYVPRDRKY RNGDRPNRVT  120
ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPTTDADLF  180
YKFIRSSQNV SCMQSEISLC RVYKRSGIDD GHGRPSSSNA QAASARPGTS RTIIPPAGQQ  240
VSSPSSTPLS PTQQPSFHGI LGQGECSSAP LPAIMDQATP HNNAPQLHQP RPPPPPRASA  300
FASAMSSTMS VAPGARGCTY SLMALADAPM MGSSSTPGDE LSRLVGHSQA YPNHPAVGSH  360
FLPSPSSSQI PPLGEMPVSP ADKLWDWIHP DTSGSRDYGS SSFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-554620519165NO APICAL MERISTEM PROTEIN
1ut4_B2e-554620519165NO APICAL MERISTEM PROTEIN
1ut7_A2e-554620519165NO APICAL MERISTEM PROTEIN
1ut7_B2e-554620519165NO APICAL MERISTEM PROTEIN
4dul_A2e-554620519165NAC domain-containing protein 19
4dul_B2e-554620519165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.11e-157PREDICTED: protein FEZ isoform X2
RefseqXP_014753810.11e-157PREDICTED: protein FEZ isoform X1
TrEMBLA0A077RXL40.0A0A077RXL4_WHEAT; Uncharacterized protein
STRINGMLOC_69621.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-94NAC domain containing protein 35
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]