PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF056900070CFD_t1
Common NameTRAES_3BF056900070CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family G2-like
Protein Properties Length: 472aa    MW: 50128.5 Da    PI: 5.8767
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF056900070CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31261316156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++ LGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  TRAES3BF056900070CFD_t1 261 KARRCWSPELHRRFVNALQILGGAQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 316
                              68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.652258318IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-28259319IPR009057Homeodomain-like
SuperFamilySSF466893.41E-17259319IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-26261316IPR006447Myb domain, plants
PfamPF002491.0E-6263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MDSSPSDLTL DYTPSGNGAA SAGGGYPKQA SPVVDHHHHL SAEQATTQKL QEFLARLDDE  60
RLKIDAFKRE LPLCMQLLNQ AMEAYRQQLE ACQMGSHGGA AARAPLVLEE FIPLKNIGID  120
AAEKAAGNAP SEKANWMVSA QLWNGPAAGD AAAKGPQTPK ERSEHPLDTS PMLGGLDGGG  180
GNGVGAFLPF TKEKACMAES AALPELGLAP AEKDREADRK PYHDDGGSNG TVVSRRDVGA  240
PPTSTAPEGQ SVPPAPQTNR KARRCWSPEL HRRFVNALQI LGGAQVATPK QIRELMKVDG  300
LTNDEVKSHL QKYRLHTRRP MPAPTAPPAG APQLVVLGGI WMPPDYAAQG AGPTAIYGAH  360
PATQAHYTAA VSAQEYYQNA AAAAHHGHHM QHHQAASMVH HRAVAPTPPQ TAYKVDPVSA  420
AGSQGSSEGR RSSGGGRERS ESIEEEGEER EDEEDEDEDG MAANGDAEQI NY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13261314154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13261314154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may play a role in regulatory networks controlling development and metabolism. {ECO:0000250|UniProtKB:Q6Z869}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020184511.10.0myb family transcription factor EFM
SwissprotQ5VRW21e-143NOH1_ORYSJ; Transcription factor NIGTH1
TrEMBLW5D0I70.0W5D0I7_WHEAT; Uncharacterized protein
STRINGTraes_3B_9E032AF27.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.17e-78G2-like family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Kamrul Huda KM, et al.
    Salinity and drought tolerant OsACA6 enhances cold tolerance in transgenic tobacco by interacting with stress-inducible proteins.
    Plant Physiol. Biochem., 2014. 82: p. 229-38
    [PMID:24992889]