PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF019000220CFD_t1
Common NameTAA_ctg0464b.00150.1, TRAES_3BF019000220CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 250aa    MW: 26792 Da    PI: 8.9856
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF019000220CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.83.2e-15168223358
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                              + +r +r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN  L ke ee ++   k
  TRAES3BF019000220CFD_t1 168 AMQRHKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAHLSKEQEEANQRRLK 223
                              679*******************************************9998876544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-9166231IPR004827Basic-leucine zipper domain
PfamPF001704.4E-14168227IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139168232IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-10170219No hitNo description
CDDcd147074.02E-17170216No hitNo description
Gene3DG3DSA:1.20.5.1703.7E-14171229No hitNo description
PROSITE patternPS000360173188IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MASSRVMASS SSKPPSHTAS DLARFAQAAG RPGGGGGSGL GSMNVEELLR GIYGDAPTPA  60
PDRPASPPVP PLPAPSRQQA TARRTADEVW REITGGSGGE EEAAPASAGG AGEMTLEDFL  120
AREDGAVVRG TEEQVAMPTM ALLGGAEGAR GGGRGRKRQL MDPMDRAAMQ RHKRMIKNRE  180
SAARSRERKQ AYIAELESLV TQLEEENAHL SKEQEEANQR RLKELKEKLT PVIIAKTPSQ  240
DLRRTNSMEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5644300.0FN564430.1 Triticum aestivum chromosome 3B-specific BAC library, contig ctg0464b.
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020174700.11e-128ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLD8L9L91e-179D8L9L9_WHEAT; BZIP transcription factor domain containing protein, expressed
STRINGBRADI2G56096.11e-87(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.17e-28G-box binding factor 4
Publications ? help Back to Top
  1. Choulet F, et al.
    Megabase level sequencing reveals contrasted organization and evolution patterns of the wheat gene and transposable element spaces.
    Plant Cell, 2010. 22(6): p. 1686-701
    [PMID:20581307]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]