PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF011000010CFD_t1
Common NameTRAES_3BF011000010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family CAMTA
Protein Properties Length: 832aa    MW: 94048.3 Da    PI: 6.9437
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF011000010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1154.32.6e-48151303117
                     CG-1   3 ke.kkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYah 87 
                              +e k+rwlk++e+++iL n e + +++ +++rp+sgs++L+nr++ r+fr+DGy+w+kk++gk+ +E+he LKv++v++l+cyYa+
  TRAES3BF011000010CFD_t1  15 REvKTRWLKPREVLDILRNCELFGIQNRTPQRPPSGSWFLFNRRVHRFFRNDGYQWQKKRNGKSGNEAHEYLKVDNVKALNCYYAR 100
                              56699********************************************************************************* PP

                     CG-1  88 seenptfqrrcywlLeeelekivlvhylev 117
                              +e+nptf rr+yw+Le ++e+ivlvhy++v
  TRAES3BF011000010CFD_t1 101 AENNPTFMRRIYWMLEPAYEHIVLVHYRDV 130
                              ***************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143765.58710136IPR005559CG-1 DNA-binding domain
SMARTSM010761.5E-5513131IPR005559CG-1 DNA-binding domain
PfamPF038591.2E-4317130IPR005559CG-1 DNA-binding domain
CDDcd001020.00538305366No hitNo description
SuperFamilySSF812961.59E-11306385IPR014756Immunoglobulin E-set
SuperFamilySSF484037.46E-15509602IPR020683Ankyrin repeat-containing domain
PfamPF136374.6E-8509560No hitNo description
Gene3DG3DSA:1.25.40.204.2E-15511603IPR020683Ankyrin repeat-containing domain
CDDcd002043.34E-8512599No hitNo description
PROSITE profilePS5029715.804512572IPR020683Ankyrin repeat-containing domain
SMARTSM002480.0047540569IPR002110Ankyrin repeat
PROSITE profilePS5008811.434540572IPR002110Ankyrin repeat
SMARTSM000150.001697719IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525406.11E-5697747IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS500968.133698727IPR000048IQ motif, EF-hand binding site
PfamPF006120.0067699719IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0079720742IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.45722749IPR000048IQ motif, EF-hand binding site
PfamPF006120.004722742IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 832 aa     Download sequence    Send to blast
MQQQQQGLDI QNLQREVKTR WLKPREVLDI LRNCELFGIQ NRTPQRPPSG SWFLFNRRVH  60
RFFRNDGYQW QKKRNGKSGN EAHEYLKVDN VKALNCYYAR AENNPTFMRR IYWMLEPAYE  120
HIVLVHYRDV LEGSISVSAL NGSPTSYQNG SASRADAHSS PGLTSEIIAP RLLSRSPGSA  180
EEVSSQILTI NNESNDTSQF DWRRMLEMQL SLENKERHDV TGEILPNHDP NPIPGIQNEE  240
FDTGTNLADI FYELEEFSED NRTEGSQPYR DPIDVIRNSA WLEEDQLNSF LHSPPVTVDE  300
NQWFHIYEVS PEWAFCSESA KVVIAGDFPS NILWVLFGDV KVPAEIVQQG VIRCYTPSYL  360
GAGKVRMCML DENGKPCTEA REFGFVEKPT NTMIIGNGKP CSEAREFEFQ QRPTKSDNEL  420
LLLLNYVQML FDSHGCELFS KFRSPLPNVQ SGFPVNPSEI IGRTCEQLDH ENAVNCIMEV  480
MLNSKFEDWL SSKFEQNSEG VYLLPKQYHG VIHTIAALGY DWALKPLLNN GVPINYRDAN  540
GWTALHWAAR FGRQQMVAVL VAAGAAVGAL SDPTAEDPAA KTPASIASAY GFIGISAFLS  600
EAELTSTFHS LESQENGKPV DHNGGVSTSS AVDRVSDKCA HMDGGTDDQL ALKDSLGAIR  660
NAVQAAGCIQ ATFRVFSLKK KKQKALQNGD SSASPSMLER AALSIQKNFR CWKKRKEYQK  720
VRKNVIKIQA RFRAHRERNK YKELLQSVGI LEKIMLRWFR KGVGLRGINS RAMPIDQDEE  780
EDIVKVFRKE RVETAVSEAV SRVSAIVGCP VARLDYRRML EMHQQAKIGH GK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC6866960.0KC686696.1 Triticum aestivum calmodulin-binding transcription activator 4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564956.10.0PREDICTED: calmodulin-binding transcription activator 4-like isoform X1
TrEMBLA0A077RZB50.0A0A077RZB5_WHEAT; Uncharacterized protein
STRINGBRADI2G59137.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94073440
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16940.11e-101calmodulin binding;transcription regulators
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]