PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G423800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 648aa    MW: 72140.8 Da    PI: 4.8208
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G423800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3510.76.6e-156784671354
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX......XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.....tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpveg 86 
                         eel++rmw+d+m+lkrl+e ++++ +d+ aa      g++k ++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+g
  Sevir.9G423800.1.p  78 EELERRMWRDRMKLKRLRELQQSRGKDQAAAgsgvgDGSSKPRQSQEQARRKKMSRAQDGILKYMLKMMEVCRAQGFVYGIIPEKGKPVSG 168
                         8***********************9999999999887899999************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S- CS
                EIN3  87 asdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGk 177
                         asd+LraWWkekv+fdrngpaai+kyqa+n++++ e++l t++++++hsl+elqDTtlgSLLsalmqhcdppqrr+plekgv+pPWWPtG+
  Sevir.9G423800.1.p 169 ASDNLRAWWKEKVRFDRNGPAAIAKYQADNAVPGAENEL-TSGTASPHSLQELQDTTLGSLLSALMQHCDPPQRRYPLEKGVPPPWWPTGD 258
                         ***************************************.55************************************************* PP

                         -HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX... CS
                EIN3 178 elwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss... 265
                         e+ww+elg++kdqg+ppykkphdlkkawkvsvLtavikhmsp+ie+ir+l+rqsk+lqdkm+ake  ++lsv++qee+++ ++++  +   
  Sevir.9G423800.1.p 259 EEWWPELGIPKDQGPPPYKKPHDLKKAWKVSVLTAVIKHMSPDIEKIRRLVRQSKCLQDKMTAKEISTWLSVVKQEEELYLKLHPGARppv 349
                         *************************************************************************************944445 PP

                         ..XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX............................XXXXXXXXXXXXX.XXXXXXXX.. CS
                EIN3 266 ..slrkqspkvtlsceqkedvegkkeskikhvqavktta............................gfpvvrkrkkkps.esakvsskev 325
                               ++ ++++s++ ++dv+  +e k  ++ ++k++                             ++++++kr+++ s e++ + ++  
  Sevir.9G423800.1.p 350 ptGGIASAISFNASSS-EYDVDIVDECKGDEAGNQKAAVtdptafnlgaailsdkflmptpmkeetaEVEFIQKRNAPGSaEPELMLNN-R 438
                         4322335556666655.99***7777777877777776688999********************************8865145556555.6 PP

                         ....XXXXXXX.XXXXXXXXXXXXXXXXX CS
                EIN3 326 srtcqssqfrgsetelifadknsisqney 354
                         ++tc++ q++++++  +f d+n++++++y
  Sevir.9G423800.1.p 439 VYTCNNVQCPHNDYGYGFLDRNARNSHQY 467
                         7**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.4E-13278335No hitNo description
Gene3DG3DSA:1.10.3180.101.9E-74209343IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.44E-61214338IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MMGGGLMMDQ GMVFPGVHNF VDLLQQNGDK NLGFGSLMPQ TSSGDQCVMG EGDLVDPPPE  60
SFPDAGEDDS DDDVDDIEEL ERRMWRDRMK LKRLRELQQS RGKDQAAAGS GVGDGSSKPR  120
QSQEQARRKK MSRAQDGILK YMLKMMEVCR AQGFVYGIIP EKGKPVSGAS DNLRAWWKEK  180
VRFDRNGPAA IAKYQADNAV PGAENELTSG TASPHSLQEL QDTTLGSLLS ALMQHCDPPQ  240
RRYPLEKGVP PPWWPTGDEE WWPELGIPKD QGPPPYKKPH DLKKAWKVSV LTAVIKHMSP  300
DIEKIRRLVR QSKCLQDKMT AKEISTWLSV VKQEEELYLK LHPGARPPVP TGGIASAISF  360
NASSSEYDVD IVDECKGDEA GNQKAAVTDP TAFNLGAAIL SDKFLMPTPM KEETAEVEFI  420
QKRNAPGSAE PELMLNNRVY TCNNVQCPHN DYGYGFLDRN ARNSHQYTCK YNDPLPQSTE  480
NKPPPPQPPQ SQAFQGGFNQ PNQALNNLDF SLPMDGQRSI AELMNMYDNN FMTNKNMSSD  540
SVSIMEGRPN ALPQRMQMDD GFFGQGNGVF DDVNSMMQQP QQAPVQQQQQ PQPQQQFFIR  600
DDTPFVSQMG DISGTSEFRF GSSFNMSSTV DYPGAAQQKN DGPNWYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A7e-742123431132Protein ETHYLENE INSENSITIVE 3
4zds_B7e-742123431132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a positive regulator in the ethylene response pathway (PubMed:16786297, PubMed:28829777, PubMed:27701783, PubMed:25995326). Required for the inhibition of root growth by ethylene in etiolated seedlings (PubMed:25995326, PubMed:28829777). Functions upstream of the auxin biosynthetic gene YUCCA8 and directly activates its expression (PubMed:28829777). Functions downstream of the ethylene signaling factor EIN2 in disease resistance against the rice blast fungus (Magnaporthe oryzae) (PubMed:27701783). Binds directly to the promoters of the NADPH oxidases RBOHA and RBOHB, and the jasmonate biosynthetic gene OPR4 to activate their expression during fungal infection (PubMed:27701783). May enhance disease resistance by facilitating reactive oxygen species (ROS) generation and jasmonate biosynthesis with subsequent phytoalexin accumulation during Magnaporthe oryzae infection (PubMed:27701783). Acts as negative regulator of salt tolerance (PubMed:25995326). During salt stress, activates the cation transporter HKT1, which mediates increased sodium uptake in roots, and contributes to sodium accumulation and salt toxicity (PubMed:25995326). Binds directly to the DNA sequence 5'-TGTTACAAATACC-3' in the promoter of the GA20OX2 gene to activate its expression at the transcriptional level during ethylene signaling (PubMed:30002253). Possesses transactivation activity in protoplasts (PubMed:25995326). {ECO:0000269|PubMed:16786297, ECO:0000269|PubMed:25995326, ECO:0000269|PubMed:27701783, ECO:0000269|PubMed:28829777, ECO:0000269|PubMed:30002253}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G423800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by infection with the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:27701783}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984528.10.0ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ10M410.0EIL1A_ORYSJ; Protein ETHYLENE-INSENSITIVE 3-like 1a
TrEMBLK4A6W10.0K4A6W1_SETIT; Uncharacterized protein
STRINGSi034617m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-163EIL family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yang C, et al.
    MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.
    Plant Physiol., 2015. 169(1): p. 148-65
    [PMID:25995326]
  3. Yang C, et al.
    Activation of ethylene signaling pathways enhances disease resistance by regulating ROS and phytoalexin production in rice.
    Plant J., 2017. 89(2): p. 338-353
    [PMID:27701783]
  4. Qin H, et al.
    The activation of OsEIL1 on YUC8 transcription and auxin biosynthesis is required for ethylene-inhibited root elongation in rice early seedling development.
    PLoS Genet., 2017. 13(8): p. e1006955
    [PMID:28829777]
  5. Kuroha T, et al.
    Ethylene-gibberellin signaling underlies adaptation of rice to periodic flooding.
    Science, 2018. 361(6398): p. 181-186
    [PMID:30002253]