PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G165100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family B3
Protein Properties Length: 581aa    MW: 65839.6 Da    PI: 8.9866
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G165100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B360.13.9e-1939121894
                         -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                          d+++++r+++p++f++++ gk   s+ + le+++g  ++v++  + + +++vl++GW+ Fv+an+++e+Df++F+++++s+fe ++
  Sevir.9G165100.1.p  39 VDANSRHRMIIPNRFVKRFAGK--LSRIINLESPNGGLYDVEV--KERYNKTVLQRGWEAFVDANRVQENDFLLFHHIEKSRFEVLI 121
                         58899**************988..8899***************..999999**************************9989996554 PP

2B343.27.2e-14248344196
                         EEEE-..-HHHHT.T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.S CS
                  B3   1 ffkvltpsdvlks.grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.s 88 
                         f++++ +s+v +s + lv++k++a +h     e++ ltl+   ++++W  ++ +r+ ++ y+l++ W +Fv++n+++egD++++   ++ +
  Sevir.9G165100.1.p 248 FVSIMRKSNVQTSgAYLVISKEYALAHFPH--ETTFLTLQRpGKSKKWHPRFYIRNDRRVYMLRGQWLDFVRDNHVQEGDICLLLPAKSgR 336
                         67788888888886789**********633..4556999985566*******77888888************************9776657 PP

                         EE..EEEE CS
                  B3  89 efelvvkv 96 
                         +f l+v +
  Sevir.9G165100.1.p 337 KFMLTVYL 344
                         77776665 PP

3B348.41.6e-15487577699
                         ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEE CS
                  B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvk 95 
                         t+ dv+ +++l +  ++a++h  + e+    ++ + + + W+ k+ +r++  r +l+ GW eFv++n L++gD+++F+l+++ +e ++ v+
  Sevir.9G165100.1.p 487 TSVDVTHNKMLEFGTQYAAAHLPVREQ---TMVLQCNAKIWNTKMEIRNG-HRLFLRVGWPEFVRDNSLRVGDICLFELKKNeRELTMEVQ 573
                         67899999999999****999655333...45566799*******65544.5799*************************99899999999 PP

                         EE-S CS
                  B3  96 vfrk 99 
                         ++++
  Sevir.9G165100.1.p 574 IISR 577
                         9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.51E-2131127IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.47932125IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-2032127IPR015300DNA-binding pseudobarrel domain
CDDcd100171.87E-1934122No hitNo description
SMARTSM010195.2E-1235125IPR003340B3 DNA binding domain
PfamPF023621.1E-1638120IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-18240337IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.59E-19243345IPR015300DNA-binding pseudobarrel domain
CDDcd100171.29E-18248343No hitNo description
PfamPF023621.8E-12248345IPR003340B3 DNA binding domain
SMARTSM010195.7E-8248348IPR003340B3 DNA binding domain
PROSITE profilePS5086311.152249346IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-19472576IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.45E-17473575IPR015300DNA-binding pseudobarrel domain
CDDcd100172.34E-17478572No hitNo description
PROSITE profilePS5086312.308482578IPR003340B3 DNA binding domain
SMARTSM010195.5E-10483578IPR003340B3 DNA binding domain
PfamPF023621.2E-13487577IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MARTRSGGSR MKKPCKCCRR YLDHLEGKNQ PMSYFFRRVD ANSRHRMIIP NRFVKRFAGK  60
LSRIINLESP NGGLYDVEVK ERYNKTVLQR GWEAFVDANR VQENDFLLFH HIEKSRFEVL  120
ILGSDGCEKV FPCAGVRNTP SIQERSLDSV DISSSSCHET TESSESERFA RCGRSSSSHR  180
RRMAATSSSF EESGEDTPSR NKSFESGDDL QTPPRDGYVL SCRRYLSEAQ KGKVIALIQK  240
IKPEVTVFVS IMRKSNVQTS GAYLVISKEY ALAHFPHETT FLTLQRPGKS KKWHPRFYIR  300
NDRRVYMLRG QWLDFVRDNH VQEGDICLLL PAKSGRKFML TVYLLHATDT CPRGGSGTVG  360
FPRVGPFHDR SSAEMTSVVH IKEESTDGEH VSSESSMKEV SDGSLNSNDS GGPSEELTDG  420
EHVSSESSMK EFSEASLNSN DSGGPSDPPY ILPAMSCLSK SQKKIVEAKV RAIQSEVPIY  480
VVIMKRTSVD VTHNKMLEFG TQYAAAHLPV REQTMVLQCN AKIWNTKMEI RNGHRLFLRV  540
GWPEFVRDNS LRVGDICLFE LKKNERELTM EVQIISREQF *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G165100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022679276.10.0B3 domain-containing protein Os03g0619600
SwissprotQ6AV221e-171Y3196_ORYSJ; B3 domain-containing protein Os03g0619600
TrEMBLA0A368SHL10.0A0A368SHL1_SETIT; Uncharacterized protein
STRINGSi039191m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.11e-14B3 family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]