PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 587aa    MW: 63019.5 Da    PI: 7.639
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.23.8e-14287326241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.7.p 287 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 326
                         6899*********************************987 PP

2TCR51.12.7e-16372411140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.7.p 372 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 411
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13286327IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538287412IPR005172CRC domain
PfamPF036384.1E-10289324IPR005172CRC domain
SMARTSM011141.5E-14372413IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.0E-12374410IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MESSTSGRKV QENELAKQYN DDLAACSLNH LISHSGTGNG VMSKSGLSLE AQQLSWNLRS  60
DDVIFSKSFM PMDQGNSEDS QKKKFDGSTG CYIQSAADNT HVYCAGATEG VATNHDPEML  120
PGVIQSQLVS NEYFFDTFKV PSDDMALSED QCGRLHRCSL FNEKVGASDM SVQSGSNPHL  180
ANICGDNYLK PAGSPVYALP GIGLHLNAVA SNSSNNMPFT INPPLQPEHN SPTTIVSCSE  240
TGLYSSEVYT RIHDDHSSQK TMPNANESCQ ESHKKKRRKL QNGDGDSCRR CSCKKSKCLK  300
LYCACFAAKV YCSGFCSCQG CLNNHTHEET VSCIRKRTES RNPLAFAPTV TRACDSGSDF  360
GDNSNNTPAS ARHKRGCNCR KSSCLKKYCE CFQSGVGCSM SCRCESCKNS FGKREGVLLL  420
ATAKMEKGAK AKGTRSTEEK LAFDKQDVVG QSGDLPSTEN LFATPSLGPC RSSILPPSTC  480
SEPPLSTAGY SSRLHNSQSP IKADVLLSYF DTCAAEMIVG DDSANIQEVG SSCISSVKVV  540
SPNKKRVSPL HTGTGLSPIG RSGRKLVLKS IPSFPSLTGD ADSEPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A8e-1329140914120Protein lin-54 homolog
5fd3_B8e-1329140914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1273277KKKRR
2273278KKKRRK
3274278KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.7.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982356.20.0protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.15e-66Tesmin/TSO1-like CXC domain-containing protein