PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 552aa    MW: 59353.5 Da    PI: 7.7168
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.33.5e-14252291241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.6.p 252 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 291
                         6899*********************************987 PP

2TCR51.22.5e-16337376140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.6.p 337 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 376
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13251292IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538252377IPR005172CRC domain
PfamPF036383.8E-10254289IPR005172CRC domain
SMARTSM011141.5E-14337378IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.5E-12339375IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MESSTSGRKV QENELAKQYN DDLAACSLNH LISHSGTGNG VMSKSGLSLE AQQLSWNLRS  60
DDVIFSKSFM PMDQGNSEDS QKKKFDGSTG CYIQSAADNT HVYCAGATEG VATNHDPEML  120
PGVIQSQLVS NEYFFDTFKV PSDDMALSED QCGRLHRCSL FNEKVGASDM SVQSGSNPHL  180
ANICGDNYLK PAGSPVYALP VSCSETGLYS SEVYTRIHDD HSSQKTMPNA NESCQESHKK  240
KRRKLQNGDG DSCRRCSCKK SKCLKLYCAC FAAKVYCSGF CSCQGCLNNH THEETVSCIR  300
KRTESRNPLA FAPTVTRACD SGSDFGDNSN NTPASARHKR GCNCRKSSCL KKYCECFQSG  360
VGCSMSCRCE SCKNSFGKRE GVLLLATAKM EKGAKAKGTR STEEKLAFDK QDVVGQSGDL  420
PSTENLFATP SLGPCRSSIL PPSTCSEPPL STAGYSSRLH NSQSPIKADV LLSYFDTCAA  480
EMIVGDDSAN IQEVGSSCIS SVKVVSPNKK RVSPLHTGTG LSPIGRSGRK LVLKSIPSFP  540
SLTGDADSEP H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1325637414120Protein lin-54 homolog
5fd3_B6e-1325637414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238242KKKRR
2238243KKKRRK
3239243KKRRK
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.6.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698176.10.0protein tesmin/TSO1-like CXC 2 isoform X2
SwissprotF4JIF53e-74TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-63TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]