PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 727aa    MW: 77901.8 Da    PI: 6.5819
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.84.9e-14427466241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.4.p 427 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 466
                         6899*********************************987 PP

2TCR50.73.6e-16512551140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.4.p 512 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 551
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13426467IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538427552IPR005172CRC domain
PfamPF036385.3E-10429464IPR005172CRC domain
SMARTSM011141.5E-14512553IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.1E-12514550IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MDPPESPPAG QPSFTDVSLY EDSPVFDFIN SLSPIATPKP LDSAQNGQLF KSSDLVPVSS  60
IFTSPQVNPQ KESKPGIRDG YIQLSQGLSP NCQRNQIGSS SCIELSGSPT IPSENCSPSE  120
DATILPSKWP QPIPLGSETL GDAKKQDTDG KADHSSDVGQ VKLSSTCYDQ NGVDQMESST  180
SGRKVQENEL AKQYNDDLAA CSLNHLISHS GTGNGVMSKS GLSLEAQQLS WNLRSDDVIF  240
SKSFMPMDQG NSEDSQKKKF DGSTGCYIQS AADNTHVYCA GATEGVATNH DPEMLPGVIQ  300
SQLVSNEYFF DTFKVPSDDM ALSEDQCGRL HRCSLFNEKV GASDMSVQSG SNPHLANICG  360
DNYLKPAGSP VYALPVSCSE TGLYSSEVYT RIHDDHSSQK TMPNANESCQ ESHKKKRRKL  420
QNGDGDSCRR CSCKKSKCLK LYCACFAAKV YCSGFCSCQG CLNNHTHEET VSCIRKRTES  480
RNPLAFAPTV TRACDSGSDF GDNSNNTPAS ARHKRGCNCR KSSCLKKYCE CFQSGVGCSM  540
SCRCESCKNS FGKREGVLLL ATAKMEKGAK AKGTRSTEEK LAFDKQDVVG QSGDLPSTEN  600
LFATPSLGPC RSSILPPSTC SEPPLSTAGY SSRLHNSQSP IKADVLLSYF DTCAAEMIVG  660
DDSANIQEVG SSCISSVKVV SPNKKRVSPL HTGTGLSPIG RSGRKLVLKS IPSFPSLTGD  720
ADSEPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1243154914120Protein lin-54 homolog
5fd3_B1e-1243154914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1413417KKKRR
2413418KKKRRK
3414418KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797028.10.0uncharacterized protein LOC112877044 isoform X2
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-61TESMIN/TSO1-like CXC 2