PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 742aa    MW: 79452.7 Da    PI: 6.9262
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.85.1e-14442481241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.3.p 442 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 481
                         6899*********************************987 PP

2TCR50.73.7e-16527566140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.3.p 527 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 566
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13441482IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538442567IPR005172CRC domain
PfamPF036385.5E-10444479IPR005172CRC domain
SMARTSM011141.5E-14527568IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.3E-12529565IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MDSPVFDFIN SLSPIATPKP LDSAQNGQLF KSSDLVPVSS IFTSPQVNPQ KESKPGIRDG  60
YIQLSQGLSP NCQRNQIGSS SCIELSGSPT IPSENCSPSE DATILPSKWP QPIPLGSETL  120
GDAKKQDTDG KADHSSDVGQ VKLSSTCYDQ NGVDQMESST SGRKVQENEL AKQYNDDLAA  180
CSLNHLISHS GTGNGVMSKS GLSLEAQQLS WNLRSDDVIF SKSFMPMDQG NSEDSQKKKF  240
DGSTGCYIQS AADNTHVYCA GATEGVATNH DPEMLPGVIQ SQLVSNEYFF DTFKVPSDDM  300
ALSEDQCGRL HRCSLFNEKV GASDMSVQSG SNPHLANICG DNYLKPAGSP VYALPGIGLH  360
LNAVASNSSN NMPFTINPPL QPEHNSPTTI VSCSETGLYS SEVYTRIHDD HSSQKTMPNA  420
NESCQESHKK KRRKLQNGDG DSCRRCSCKK SKCLKLYCAC FAAKVYCSGF CSCQGCLNNH  480
THEETVSCIR KRTESRNPLA FAPTVTRACD SGSDFGDNSN NTPASARHKR GCNCRKSSCL  540
KKYCECFQSG VGCSMSCRCE SCKNSFGKRE GVLLLATAKM EKGAKAKGTR STEEKLAFDK  600
QDVVGQSGDL PSTENLFATP SLGPCRSSIL PPSTCSEPPL STAGYSSRLH NSQSPIKADV  660
LLSYFDTCAA EMIVGDDSAN IQEVGSSCIS SVKVVSPNKK RVSPLHTGTG LSPIGRSGRK  720
LVLKSIPSFP SLTGDADSEP H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1244656414120Protein lin-54 homolog
5fd3_B1e-1244656414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1428432KKKRR
2428433KKKRRK
3429433KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797027.10.0protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.19e-65Tesmin/TSO1-like CXC domain-containing protein