PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 707aa    MW: 75786.6 Da    PI: 6.973
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.94.8e-14407446241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.2.p 407 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 446
                         6899*********************************987 PP

2TCR50.73.5e-16492531140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.2.p 492 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 531
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13406447IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538407532IPR005172CRC domain
PfamPF036385.2E-10409444IPR005172CRC domain
SMARTSM011141.5E-14492533IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.8E-12494530IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MDSPVFDFIN SLSPIATPKP LDSAQNGQLF KSSDLVPVSS IFTSPQVNPQ KESKPGIRDG  60
YIQLSQGLSP NCQRNQIGSS SCIELSGSPT IPSENCSPSE DATILPSKWP QPIPLGSETL  120
GDAKKQDTDG KADHSSDVGQ VKLSSTCYDQ NGVDQMESST SGRKVQENEL AKQYNDDLAA  180
CSLNHLISHS GTGNGVMSKS GLSLEAQQLS WNLRSDDVIF SKSFMPMDQG NSEDSQKKKF  240
DGSTGCYIQS AADNTHVYCA GATEGVATNH DPEMLPGVIQ SQLVSNEYFF DTFKVPSDDM  300
ALSEDQCGRL HRCSLFNEKV GASDMSVQSG SNPHLANICG DNYLKPAGSP VYALPVSCSE  360
TGLYSSEVYT RIHDDHSSQK TMPNANESCQ ESHKKKRRKL QNGDGDSCRR CSCKKSKCLK  420
LYCACFAAKV YCSGFCSCQG CLNNHTHEET VSCIRKRTES RNPLAFAPTV TRACDSGSDF  480
GDNSNNTPAS ARHKRGCNCR KSSCLKKYCE CFQSGVGCSM SCRCESCKNS FGKREGVLLL  540
ATAKMEKGAK AKGTRSTEEK LAFDKQDVVG QSGDLPSTEN LFATPSLGPC RSSILPPSTC  600
SEPPLSTAGY SSRLHNSQSP IKADVLLSYF DTCAAEMIVG DDSANIQEVG SSCISSVKVV  660
SPNKKRVSPL HTGTGLSPIG RSGRKLVLKS IPSFPSLTGD ADSEPH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1241152914120Protein lin-54 homolog
5fd3_B1e-1241152914120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1393397KKKRR
2393398KKKRRK
3394398KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797028.10.0uncharacterized protein LOC112877044 isoform X2
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.16e-62TESMIN/TSO1-like CXC 2