PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G159400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 762aa    MW: 81567.9 Da    PI: 6.5742
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G159400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.85.2e-14462501241
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++++C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Sevir.9G159400.1.p 462 SCRRCSCKKSKCLKLYCACFAAKVYCSGFCSCQGCLNNHT 501
                         6899*********************************987 PP

2TCR50.63.8e-16547586140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Sevir.9G159400.1.p 547 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 586
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-13461502IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.538462587IPR005172CRC domain
PfamPF036385.6E-10464499IPR005172CRC domain
SMARTSM011141.5E-14547588IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.6E-12549585IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 762 aa     Download sequence    Send to blast
MDPPESPPAG QPSFTDVSLY EDSPVFDFIN SLSPIATPKP LDSAQNGQLF KSSDLVPVSS  60
IFTSPQVNPQ KESKPGIRDG YIQLSQGLSP NCQRNQIGSS SCIELSGSPT IPSENCSPSE  120
DATILPSKWP QPIPLGSETL GDAKKQDTDG KADHSSDVGQ VKLSSTCYDQ NGVDQMESST  180
SGRKVQENEL AKQYNDDLAA CSLNHLISHS GTGNGVMSKS GLSLEAQQLS WNLRSDDVIF  240
SKSFMPMDQG NSEDSQKKKF DGSTGCYIQS AADNTHVYCA GATEGVATNH DPEMLPGVIQ  300
SQLVSNEYFF DTFKVPSDDM ALSEDQCGRL HRCSLFNEKV GASDMSVQSG SNPHLANICG  360
DNYLKPAGSP VYALPGIGLH LNAVASNSSN NMPFTINPPL QPEHNSPTTI VSCSETGLYS  420
SEVYTRIHDD HSSQKTMPNA NESCQESHKK KRRKLQNGDG DSCRRCSCKK SKCLKLYCAC  480
FAAKVYCSGF CSCQGCLNNH THEETVSCIR KRTESRNPLA FAPTVTRACD SGSDFGDNSN  540
NTPASARHKR GCNCRKSSCL KKYCECFQSG VGCSMSCRCE SCKNSFGKRE GVLLLATAKM  600
EKGAKAKGTR STEEKLAFDK QDVVGQSGDL PSTENLFATP SLGPCRSSIL PPSTCSEPPL  660
STAGYSSRLH NSQSPIKADV LLSYFDTCAA EMIVGDDSAN IQEVGSSCIS SVKVVSPNKK  720
RVSPLHTGTG LSPIGRSGRK LVLKSIPSFP SLTGDADSEP H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1246658414120Protein lin-54 homolog
5fd3_B2e-1246658414120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1448452KKKRR
2448453KKKRRK
3449453KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G159400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025797027.10.0protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A368SHB60.0A0A368SHB6_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147741921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-64Tesmin/TSO1-like CXC domain-containing protein