PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G119900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GeBP
Protein Properties Length: 368aa    MW: 39022.5 Da    PI: 6.8733
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G119900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57383.92.2e-2682176297
              DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifels 92 
                         +fqr+wse+De+ +LqGl+ +   +g     d++ fy+ +++s+   +++ ql+eK+rrLK+K++  +++++ g +p+  ++hd+++++l+
  Sevir.9G119900.1.p  82 KFQRIWSESDELRFLQGLLGC-GAQGLVFPRDLNVFYDRFSESMPQPYTRAQLSEKLRRLKNKYRSVSARVAGGLDPARLAPHDRDVLHLC 171
                         79*******************.556878888************************************************************ PP

              DUF573  93 kkiWg 97 
                         +++W+
  Sevir.9G119900.1.p 172 SRLWD 176
                         ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.9E-2483176IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MASGQQALPV PAPVPPNPNP TAPADLTPPA ASAGARKLPI KRRSPRPSSS PPSSSSPASS  60
DPLRAPTAGG GGGSDQQQPP FKFQRIWSES DELRFLQGLL GCGAQGLVFP RDLNVFYDRF  120
SESMPQPYTR AQLSEKLRRL KNKYRSVSAR VAGGLDPARL APHDRDVLHL CSRLWDPANA  180
ATSPFASGAG SSGNKRRRAN PRGTPLPPPD ASGDCNSHDY NGISSSAPGL FPEVSNGEDM  240
FYLEQESGHL GDHEGAALVA DSRFGVIVQQ PEAAAALPNG IGNEMNGDQK MVVPCSNEHR  300
MANAVLDVFE ACLREAKSNG IINGGNADGS AEESELAKRW RVQRMDELDV LSQRLRLLVE  360
DAAAAGH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.9G119900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9677790.0EU967779.1 Zea mays clone 306034 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982018.10.0probable transcription factor At3g04930
TrEMBLK4ABK00.0K4ABK0_SETIT; Uncharacterized protein
STRINGSi036257m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.21e-12DNA-binding storekeeper protein-related transcriptional regulator