PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G260900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 628aa    MW: 70662 Da    PI: 6.7598
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G260900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.71.2e-1042436162374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cAeav+s+d + a  lL+r+++++sp+gd ++Rla++f+ +L+arla+++s++y+ +  + ts  +++ +l+a+++    + +l 
  Sevir.8G260900.1.p 243 HTLLIRCAEAVASNDYRGAADLLERIKHHSSPTGDGTHRLAHCFAMGLEARLAGTGSQIYRLFMDKLTS--STVGVLKAYQFHMTSCCFLL 331
                         679**********************************************************99888887..588999************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++hl  N++I++av g +++Hi+ ++++ GlQWp Ll+ La R++gpp++R+Tg+++p++g   ++ +eetg+rL++ A+++gvpf+f+  
  Sevir.8G260900.1.p 332 VQHLFSNKTIYNAVTGRKKLHIVHYGLGRGLQWPDLLRWLARRDGGPPEVRLTGIDNPQPGfrPAQHIEETGHRLSECARRIGVPFRFRG- 421
                         ******************************************************************************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +ak+le++++e+L+++p+E+l++n++l+l++l+desv +e   +rd vL+++++++P v++++ ++ +h+s+ F++rf e l+ y+alfd+
  Sevir.8G260900.1.p 422 IAKKLEAVQVEDLDIDPDEVLVINSILHLQSLMDESVFVERsnPRDMVLSTIRKMRPSVFIHAVNNGSHSSAFFMTRFREVLHSYTALFDM 512
                         7***********************************98776669*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         ++a +pr++++r  vEr +++  i+n++aceg +r++r +++++W+ r ++aG++++pl+ ++++  k  ++k + + + ++e++++l++g
  Sevir.8G260900.1.p 513 MDAIAPRDDDKRLLVERDMFAACITNIIACEGMDRVQRPQSYKQWQIRSQRAGLRQLPLDPEIVQMLKDKVKKEYHKSFVINEDQHWLLQG 603
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         Wk+r L+++S+W+
  Sevir.8G260900.1.p 604 WKGRVLYALSMWT 616
                         ************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.56216596IPR005202Transcription factor GRAS
PfamPF035144.2E-102243616IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MAETTQQPSP SVFLDDLPLL APCIIDIDGG KDDSSPEDDG NLVLPYISRM LMEDITGEFS  60
DRYNPDHPAL LKAQQPFAEI LSNAIQKCPC KQLSQPAPLR MDTVEAKSLQ LMTAKGSSCV  120
DVVSMAFFKG MEEANKFLPI PTDSDETVWP SCRRKKKRLD RDDETTAQAQ EVGMSTSKQM  180
AASLQPAETE EEAAAREMLD RLMLNGYDHP SLAADMLEPP YVAIGMMGKT TPPRGKRHAV  240
DLHTLLIRCA EAVASNDYRG AADLLERIKH HSSPTGDGTH RLAHCFAMGL EARLAGTGSQ  300
IYRLFMDKLT SSTVGVLKAY QFHMTSCCFL LVQHLFSNKT IYNAVTGRKK LHIVHYGLGR  360
GLQWPDLLRW LARRDGGPPE VRLTGIDNPQ PGFRPAQHIE ETGHRLSECA RRIGVPFRFR  420
GIAKKLEAVQ VEDLDIDPDE VLVINSILHL QSLMDESVFV ERSNPRDMVL STIRKMRPSV  480
FIHAVNNGSH SSAFFMTRFR EVLHSYTALF DMMDAIAPRD DDKRLLVERD MFAACITNII  540
ACEGMDRVQR PQSYKQWQIR SQRAGLRQLP LDPEIVQMLK DKVKKEYHKS FVINEDQHWL  600
LQGWKGRVLY ALSMWTADDD RSVLAQT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-412466158374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152157RRKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980083.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809331e-134SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZHQ90.0K3ZHQ9_SETIT; Uncharacterized protein
STRINGSi026111m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-135GRAS family protein