PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G260700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 819aa    MW: 89565.3 Da    PI: 4.8703
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G260700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.82.4e-1044378101374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++ L++cA+ v++gd +   +lL ++++++sp+gd++qRla++f+e+L+arla+++s++y++l +++ts   +++ l+a+kl+  ++ ++
  Sevir.8G260700.1.p 437 LRTMLIHCAQSVATGDRRSGIELLRQIKQHSSPKGDATQRLAHCFAEGLEARLAGTGSQVYQSLVAQRTS---VVDFLKAYKLYMVACCYM 524
                         5789**************************************************************9999...****************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+ +     +I +av+g +++Hi+ +++++G+Q+p Ll +La+R++gpp++R+T+++ p++g   ++++eetg+rL++ A+elgvpf+fn+
  Sevir.8G260700.1.p 525 KVKFTFSTATICNAVAGRSKLHIVEYGVQHGFQYPGLLYTLAKRKGGPPEVRVTAIAVPQPGfrPAHQIEETGHRLSNCARELGVPFKFNA 615
                         *************************************************************9*9*************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          +  ++e+++ ++L+++p+E+l+Vn+     +l+desv ++s  +rd vL+ +++++P+v++++  +   +++ Fl+rf eal +ysa fd
  Sevir.8G260700.1.p 616 -ILAQWETVRAKDLNIDPEEVLVVNSECFWGNLMDESVLVDSpsPRDMVLNNIREMRPNVFIHSVVNGTFGAPFFLTRFREALFFYSAQFD 705
                         .6999********************************98877779********************************************** PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                         +l+a++pr+++er  +Er ++gr++ nv+acega+r+er et+++W  r ++aG++++pl+++aak  +  +++++ + + ++e++ +l+l
  Sevir.8G260700.1.p 706 MLDATIPRDNDERLLIERDVIGRSALNVIACEGADRVERPETYKQWLVRNHRAGLRQLPLDSEAAKVSRDKVKNYYHRDFLIDEDNRWLLL 796
                         ****************************************************************************999************ PP

                GRAS 361 gWkdrpLvsvSaWr 374
                         gWk+r L+++S+W+
  Sevir.8G260700.1.p 797 GWKGRVLYAMSSWT 810
                         *************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.639411790IPR005202Transcription factor GRAS
PfamPF035148.1E-102437810IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 819 aa     Download sequence    Send to blast
MSATPEEFLG QGAYLAAPEP FSPSVFLDLP PTPRPDADDP DASDDLVLPF ISRMLMEEDI  60
DDKFFYQFPD HPALLNAQQP YAQILSDTTA SSSSDSAATN TTSSGTAANS TLSPPSSDAP  120
SSAEPAWPYD SIELSQLLRS PPYPDMGVGL DDFTADDVDA LLLQGRQEGA TAGFHQSPPV  180
LDTGGGGGGQ RQGASLATQN AGSGESQRPR ASLAAQNAAG DGSQRQRDSF AAQNAGGGAG  240
IRSLPADEQE TKTANATALP AADTDHATLA SAFFGAQNGE NMDMLNMAFL KGMEEAKKFL  300
PTNNSLLMDL EANSGQSTDS KPVTGFTAAR VKEEEVVDGM LLFGGGTTNG RGRKNRYTQE  360
DLEAETGRSS KLMMPEQEET GASELYSEIM SLNYEEFMKR MSDLRIAMDS ESEKSARKVS  420
GKKGARGRQR ADEVVDLRTM LIHCAQSVAT GDRRSGIELL RQIKQHSSPK GDATQRLAHC  480
FAEGLEARLA GTGSQVYQSL VAQRTSVVDF LKAYKLYMVA CCYMKVKFTF STATICNAVA  540
GRSKLHIVEY GVQHGFQYPG LLYTLAKRKG GPPEVRVTAI AVPQPGFRPA HQIEETGHRL  600
SNCARELGVP FKFNAILAQW ETVRAKDLNI DPEEVLVVNS ECFWGNLMDE SVLVDSPSPR  660
DMVLNNIREM RPNVFIHSVV NGTFGAPFFL TRFREALFFY SAQFDMLDAT IPRDNDERLL  720
IERDVIGRSA LNVIACEGAD RVERPETYKQ WLVRNHRAGL RQLPLDSEAA KVSRDKVKNY  780
YHRDFLIDED NRWLLLGWKG RVLYAMSSWT AEDNKPLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-364418098374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980079.10.0PREDICTED: scarecrow-like protein 34
TrEMBLK3ZHD30.0K3ZHD3_SETIT; Uncharacterized protein
STRINGSi025985m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-146SCARECROW-like 14