PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G279600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 613aa    MW: 68963.7 Da    PI: 6.3573
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G279600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS274.33.9e-8424160610373
                GRAS  10 eavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                          av+++d   a++lL++++ +as++gd +qRla++f+++L+arl++++s++ +  + + +++ + +e l a++l+  ++ + k+  l    
  Sevir.7G279600.1.p 241 XAVAANDDMTASELLKQIKXHASETGDVTQRLAQCFAKGLEARLVGMGSQVWQLWQLRMADRLSIVELLEARNLYAAACSFNKVVLLFSTM 331
                         5899********************************************************9999*************************** PP

                GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                         +Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++gpp+++iT++g+p+     +e++ee+g rL+k A+e+gvpf+f + + k++e++
  Sevir.7G279600.1.p 332 TILQAMVGKGRLHIVDYGMRYGFHWADLLRLLASREGGPPKVKITAIGPPNLRpcPTEQIEEIGYRLSKCAHEFGVPFNFYA-IRKKWEEV 421
                         *************************************************999999***************************.7******* PP

                GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         ++e+L+++ gE+l+Vn  l+  +l+des   ++  ++d vL+ +++++P +++ +  ++++ ++s+l rf e + y+sa+fd ++a++pr+
  Sevir.7G279600.1.p 422 SIEDLNTDAGEVLIVNDRLNFNSLMDESIFFDDpsPKDIVLHNIRKMRPAIFIQSIVNSSY-GSSYLSRFREVVFYFSAIFDLFDATIPRD 511
                         ****************************977766699***********************9.6789************************* PP

                GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                         s+ r+++E+ l+g  + n++aceg++  +r e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l++gW++r L++
  Sevir.7G279600.1.p 512 SKLRVVLEQDLFGGLALNAIACEGTDLMNRPEKYKQWHARNQRAGLRQLPLKPSIVNALKDEVMRCYHRDFLICEDGQWLLQGWMGRILFA 602
                         *******************************************************************999********************* PP

                GRAS 370 vSaW 373
                          S W
  Sevir.7G279600.1.p 603 QSTW 606
                         **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.138206587IPR005202Transcription factor GRAS
PfamPF035141.3E-81241606IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MATTPDELFV EGLTEMSPQS PSVFLDVFSP KPDDRSEGCH HVPSDMMLPY ISRMLMEDDI  60
DDKPADHPAL LQVQQPFAQI LSSPSFGSNH GDTEGANDLL QDSSGDERTL HLALSKGTYA  120
VGAFLKGMKE ANMLLPIANN GFRRDKLVNQ MVSESSNHSG AKKRYARDDH IEEGEARRTS  180
KSLMRVTEPK DTCAHEMLDD MMLRGTEXXI IRCMEKLRIA MANGXEKTTR KGSRNAVAKN  240
XAVAANDDMT ASELLKQIKX HASETGDVTQ RLAQCFAKGL EARLVGMGSQ VWQLWQLRMA  300
DRLSIVELLE ARNLYAAACS FNKVVLLFST MTILQAMVGK GRLHIVDYGM RYGFHWADLL  360
RLLASREGGP PKVKITAIGP PNLRPCPTEQ IEEIGYRLSK CAHEFGVPFN FYAIRKKWEE  420
VSIEDLNTDA GEVLIVNDRL NFNSLMDESI FFDDPSPKDI VLHNIRKMRP AIFIQSIVNS  480
SYGSSYLSRF REVVFYFSAI FDLFDATIPR DSKLRVVLEQ DLFGGLALNA IACEGTDLMN  540
RPEKYKQWHA RNQRAGLRQL PLKPSIVNAL KDEVMRCYHR DFLICEDGQW LLQGWMGRIL  600
FAQSTWVADD TS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2924360614374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YCU60.0K3YCU6_SETIT; Uncharacterized protein
STRINGSi012046m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-98SCARECROW-like 14