PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G279500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 595aa    MW: 67024.9 Da    PI: 6.969
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G279500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS278.42.1e-8522558810373
                GRAS  10 eavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                         +av+++d   a++lL++++ +as++gd +qRla++f+++L+arl++++s++ +  ++ + ++  ++e l+a++l+  ++ + ++  l    
  Sevir.7G279500.1.p 225 NAVAANDDMTASELLKQIKXHASETGDVTQRLAQCFAKGLEARLVGMGSQVWQLRTADRLRP--TVEFLKAHNLLTAACSFNRVVLLFSTM 313
                         79***********************************************9998776666664..99************************* PP

                GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                         +Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++g+p+++iT++g+p+    s e++eetg rL+k A+e+gvpf+f + + k++e++
  Sevir.7G279500.1.p 314 TILQAMVGKGRLHIVDYGMHHGFHWADLLRLLASREGGTPKVKITAIGHPDLRpcSIEQIEETGYRLSKCAHEFGVPFNFYA-IRKKWEEV 403
                         *************************************************999899***************************.7******* PP

                GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                         ++e+L+++ gE+l+Vn +l+  +l+des   ++  +++ vL+ +++++P v++ +  ++++ ++s+l rf e + y+sa+fd+++a++pr+
  Sevir.7G279500.1.p 404 SIEDLNTDAGEVLIVNDHLNFNTLMDESIFFADpsPKNIVLHNIRKMRPAVFIQSIVNSSY-GASYLSRFREVVFYFSAIFDMFDATIPRD 493
                         ****************************97776558999********************99.789************************** PP

                GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                         s+ r+++E+ l+g  + n++aceg++r++r e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l+ gW++r L++
  Sevir.7G279500.1.p 494 SKCRVVLEQDLFGCFALNAIACEGTDRINRPEKYKQWHARNQRAGLRQLPLKPSIVNALKDEVMRCYHRDFLICEDGQWLLHGWMGRILFA 584
                         *******************************************************************999********************* PP

                GRAS 370 vSaW 373
                          S W
  Sevir.7G279500.1.p 585 QSTW 588
                         **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.226190569IPR005202Transcription factor GRAS
PfamPF035147.3E-83225588IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MSPQSPSVFL DVFSPKPDDR SEGCHHVPSD MMLPYISRML MEDDIDDKPA DHPALLQVQQ  60
PFAQILSSPS FGSNHGDTEG ANDLLQDSSG DERTLHLALS KXTXAVGAFL KGMKEANMLL  120
PIANNGFRRD ELVNQMVSES SNHSGARKRY ARDDHIEEGE ARRTSKSLMR XXEPKDXCAH  180
EMLDDMMLRG TEPCIIRCME KLRIAMANGX EKTTRKGSRN AVAKNAVAAN DDMTASELLK  240
QIKXHASETG DVTQRLAQCF AKGLEARLVG MGSQVWQLRT ADRLRPTVEF LKAHNLLTAA  300
CSFNRVVLLF STMTILQAMV GKGRLHIVDY GMHHGFHWAD LLRLLASREG GTPKVKITAI  360
GHPDLRPCSI EQIEETGYRL SKCAHEFGVP FNFYAIRKKW EEVSIEDLNT DAGEVLIVND  420
HLNFNTLMDE SIFFADPSPK NIVLHNIRKM RPAVFIQSIV NSSYGASYLS RFREVVFYFS  480
AIFDMFDATI PRDSKCRVVL EQDLFGCFAL NAIACEGTDR INRPEKYKQW HARNQRAGLR  540
QLPLKPSIVN ALKDEVMRCY HRDFLICEDG QWLLHGWMGR ILFAQSTWVA DDTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3122858815374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978277.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YDM30.0K3YDM3_SETIT; Uncharacterized protein
STRINGSi012328m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.14e-98GRAS family protein