PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G221400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 633aa    MW: 66358.9 Da    PI: 7.3838
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G221400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS298.12.2e-912626322374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL e+A a+++g++e+a + L  l+  a+++gd+ qRl+a+++ AL++r++ + s l++      ++    +e+ a  +l++++sP+++
  Sevir.7G221400.1.p 262 RQLLSEAAVALADGNHEAAATHLVALKRAANQHGDAEQRLIAMMVAALSSRIVPTASALAQ----HLAE-LCGAEQRAGSQLLHDISPCFR 347
                         689***************************************************4444443....3333.33556667779********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgvpfe 177
                         ++  +a  aI+eav  ++++H +Dfd+s   Q  aL+q La+R+ +  sl++T+v +p+s        + +l+++ge+L+++Ae+ g++ +
  Sevir.7G221400.1.p 348 LALHAASAAIVEAVGDHRAIHLVDFDVSF-QQHTALIQYLADRRVPGTSLKVTAVIDPSSPftqtqsLTATLSAIGEQLKQLAERAGIEYR 437
                         ***************************98.7*************************999878877666778999***************** PP

                GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                         f+v v+ r ++l+ ++L + pgEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe+++n++++++rf++a+ +y a++
  Sevir.7G221400.1.p 438 FKV-VSCRAAELDASRLGCAPGEALAVNLAFALSHVPDESVSPANPRDELLRRVRALGPQVVALVEQELNTNTAPLAARFTDACAHYGAIL 527
                         **9.7999*********************************************************************************** PP

                GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                         +sl+a+l+res e++   ++ l+r++ n+v  eg +r er+e ++kWr+r+++aGF+pv+l+  +++q+ + +   +  g + + ++g l 
  Sevir.7G221400.1.p 528 ESLDATLGRESAEKKARAEAALARKAANAVGREGPDRLERCEVFGKWRARFGMAGFRPVALGPGIVDQVAARVGPAP-PGITFKADNGVLR 617
                         ***********8888888888********************************************************.9************ PP

                GRAS 360 lgWkdrpLvsvSaWr 374
                         l+W++r ++++SaWr
  Sevir.7G221400.1.p 618 LCWMGRVVTVASAWR 632
                         **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.559235613IPR005202Transcription factor GRAS
PfamPF035147.8E-89262632IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MEPGAPWRDP RQGYAYGVGS AMQMQLQQRA DAAAGGGGVL KRSLGELERW QHQQQQHVAA  60
QQALYLRAVR QRTAAAADIA ALLGGGPTQP LVLSGSSFGG GLASPSSTLS SLTTASRAAV  120
PLMHPQPQPQ LQQQRQVPLM TSSPQTQAFG LSRAPPPPQP ASPSQLFMLQ ELEKQLFDDD  180
DDESVAAMSG TGSAVTNSEW EETIQQLNSI TAAPSPGLPA SATPNNNNNA NAGMTRSPSN  240
SSSSTASSSA SCSPPTPGAA SRQLLSEAAV ALADGNHEAA ATHLVALKRA ANQHGDAEQR  300
LIAMMVAALS SRIVPTASAL AQHLAELCGA EQRAGSQLLH DISPCFRLAL HAASAAIVEA  360
VGDHRAIHLV DFDVSFQQHT ALIQYLADRR VPGTSLKVTA VIDPSSPFTQ TQSLTATLSA  420
IGEQLKQLAE RAGIEYRFKV VSCRAAELDA SRLGCAPGEA LAVNLAFALS HVPDESVSPA  480
NPRDELLRRV RALGPQVVAL VEQELNTNTA PLAARFTDAC AHYGAILESL DATLGRESAE  540
KKARAEAALA RKAANAVGRE GPDRLERCEV FGKWRARFGM AGFRPVALGP GIVDQVAARV  600
GPAPPGITFK ADNGVLRLCW MGRVVTVASA WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-3128063222375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976581.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3Y5W20.0K3Y5W2_SETIT; Uncharacterized protein
STRINGSi009601m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.16e-86SCARECROW-like 8