PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G130000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 476aa    MW: 52350.1 Da    PI: 5.8122
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G130000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN33491e-106653382262
                         XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXX................XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksn................ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgi 76 
                         +lkkrmwkdq ll++l++r+ +   + +a  g+++++                +++ ++rrk+m raQDg++++Mlk+me+cna+GfvYg 
  Sevir.7G130000.2.p  65 NLKKRMWKDQLLLMKLEGRSGRDRPHPDAGQGQQQQQpgadhwdqaltkekeeTPQARYRRKAMLRAQDGVIRHMLKMMEACNARGFVYGV 155
                         59****************99887655555444444446777777777777777************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT- CS
                EIN3  77 ipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekg 167
                         ++e+g pv+g+sdsLr+WWk++v fd++gp a+      +++ + +s +   + s  h l+++qD+tlgSLLsal+qhc+ppqr+fpl++g
  Sevir.7G130000.2.p 156 VDETGVPVSGSSDSLRGWWKDDVGFDKAGPLALLSG-VHQAAGDPGSPM---AASFLHGLHDIQDSTLGSLLSALIQHCEPPQRSFPLDRG 242
                         ********************************9977.556665544444...89************************************* PP

                         -HHHH---S--HHHHHHT.--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S CS
                EIN3 168 vepPWWPtGkelwwgelg.lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekec 257
                         ++pPWWPtG+e wwg++g ++++qg+ppy+kphdlkkawk+s+L+avikh+sp+++++r+l++qsk+lq+kmsa++  ++++v+ qee++ 
  Sevir.7G130000.2.p 243 LAPPWWPTGQETWWGSQGeAQAHQGPPPYRKPHDLKKAWKISLLSAVIKHLSPRFDQMRKLVWQSKRLQHKMSARDAETWSKVITQEEALD 333
                         ******************9999******************************************************************987 PP

                         --XXX CS
                EIN3 258 atvsa 262
                         ++ + 
  Sevir.7G130000.2.p 334 RHAQR 338
                         64433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.2E-11365330No hitNo description
Gene3DG3DSA:1.10.3180.101.4E-63205337IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.27E-56208332IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MENCESIDYY QKPSSHAASK PTTMDKAFTE DKGKVDDHAA GQEPESQDEF FSDSESGSES  60
IEIANLKKRM WKDQLLLMKL EGRSGRDRPH PDAGQGQQQQ QPGADHWDQA LTKEKEETPQ  120
ARYRRKAMLR AQDGVIRHML KMMEACNARG FVYGVVDETG VPVSGSSDSL RGWWKDDVGF  180
DKAGPLALLS GVHQAAGDPG SPMAASFLHG LHDIQDSTLG SLLSALIQHC EPPQRSFPLD  240
RGLAPPWWPT GQETWWGSQG EAQAHQGPPP YRKPHDLKKA WKISLLSAVI KHLSPRFDQM  300
RKLVWQSKRL QHKMSARDAE TWSKVITQEE ALDRHAQRAL QITPLEEDED DDGGPDAGDV  360
DSPLAAAHHV DKRKRKGTED DGEHDVKGAV AVVRDGGQHS GGGAVDEAAP VAHRDMFLHG  420
SQQHGGGAVV PHQAAANDAS SVHEHDMLRS MLGVADVVDM SDFLNSPIWQ WGVYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-482093344128Protein ETHYLENE INSENSITIVE 3
4zds_B3e-482093344128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.7G130000.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0430830.0BT043083.1 Zea mays full-length cDNA clone ZM_BFc0091K23 mRNA, complete cds.
GenBankJX4699690.0JX469969.1 Zea mays subsp. mays clone UT3232 EIL-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975828.10.0ETHYLENE INSENSITIVE 3-like 5 protein isoform X2
SwissprotQ9FJQ55e-91EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLA0A368RV070.0A0A368RV07_SETIT; Uncharacterized protein
STRINGSi009909m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.11e-91EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]