PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G117800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25514.5 Da    PI: 8.3713
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G117800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.11e-221058250
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        rien   rqvtf+kRr g+lKKA+EL vL da++ vi+fs++gk+ye +
  Sevir.7G117800.1.p 10 RIENPVHRQVTFCKRRMGLLKKANELAVLSDADIGVIVFSPHGKMYELA 58
                        8*********************************************965 PP

2K-box29.92.3e-1182158996
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                           + k +   qe+  L  eie L++            Lsl eL  Le++Le  +++i s+K+++l ++ie l++ke  lq +n +L++
  Sevir.7G117800.1.p  82 SRKMKPQAIPQEVLALTHEIELLRKD-----------LSLDELYALERNLEIWVQNICSQKMQILSREIEMLRNKEGILQAANDTLQE 158
                         55555666666666666666666665...........************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.2E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-26174IPR002100Transcription factor, MADS-box
CDDcd002653.71E-35272No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-23323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-221056IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-233859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.69560168IPR002487Transcription factor, K-box
PfamPF014861.0E-11106159IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARGKIHMRR IENPVHRQVT FCKRRMGLLK KANELAVLSD ADIGVIVFSP HGKMYELATN  60
GNMQGLIERY KTAYGEMKGE SSRKMKPQAI PQEVLALTHE IELLRKDLSL DELYALERNL  120
EIWVQNICSQ KMQILSREIE MLRNKEGILQ AANDTLQERG PPRAPPSSPP LSCVWPCTPI  180
YSSRAATIAA LEHDLAALER ECVVAENRGG AEPTAAQLGA SVWRNCPT*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.7G117800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.13e-83MADS-box transcription factor 26
SwissprotA2YQK95e-58MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-58MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A2T7CVL81e-82A0A2T7CVL8_9POAL; Uncharacterized protein
STRINGSi012632m1e-82(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-47AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]