PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G022600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family TCP
Protein Properties Length: 173aa    MW: 17864.2 Da    PI: 9.0551
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G022600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP102.19.3e-3258125673
                 TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                         +++ ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Sevir.7G022600.1.p  58 RSSADRHAKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 125
                         5788********************************************************77777333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.8E-2759139IPR005333Transcription factor, TCP
PROSITE profilePS5136924.4760114IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSSSSELVLY NLVPAPQTLN PPPPHAPAAA VSGDLTISTA VAAPPQEPLR GRARRPARSS  60
ADRHAKVAGR GRRVRIPAMV AARVFQLTRE LGHRTDGETI EWLLRQAEPS IIAATGTGVT  120
PEEAPSALVP VSPAAATASL MHVPYYTALL MQPPPTADSA SGSGAAAEEN NN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.11e-118PREDICTED: transcription factor PCF1-like
SwissprotO238754e-57PCF1_ORYSJ; Transcription factor PCF1
TrEMBLK7TSC84e-87K7TSC8_MAIZE; TCP transcription factor
STRINGGRMZM2G096610_P011e-86(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.12e-28TCP family protein