PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G097500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 420aa    MW: 46578 Da    PI: 8.8248
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G097500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR40.36.2e-13213249441
                 TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         ++C+Ck+skClk+YCeCfaag++C+   +C++C N+ +
  Sevir.6G097500.1.p 213 RNCKCKNSKCLKRYCECFAAGRYCKG-FNCTNCYNNGS 249
                         78***********************9.9*******976 PP

2TCR51.22.4e-16297337141
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                         k+++gCnC+ks+ClkkYCeCf++++ Cs++CkC dCkN e+
  Sevir.6G097500.1.p 297 KHTRGCNCRKSECLKKYCECFQSNVLCSDNCKCMDCKNYES 337
                         5899**********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.7E-7210250IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163431.22211337IPR005172CRC domain
PfamPF036386.1E-9213247IPR005172CRC domain
SMARTSM011142.0E-18297338IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12300335IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MDKPPELSLG SMHLDIASAF YAGKPEIATT AAALSQALGQ AQTCPRLQPS LQSLQSSLLL  60
WPPVIWSTWA AVKHPMPLPH LPPAKKLKLL QTSSVLTPAL PDTEALPVVE LPLPKLPVRH  120
PLPKLQVRRP LPKLQMHNPL QQASLVLEKE SLKQEMPVTP LTSATSVNLW NASKELNIFQ  180
ITSCLSHAEC FWRYLPKCVC EYLNHNLTPA GIRNCKCKNS KCLKRYCECF AAGRYCKGFN  240
CTNCYNNGSH DNARAIQDAI DAVLERRPMA FMPKVENRSC SKQSSEGKEA EGPHVGKHTR  300
GCNCRKSECL KKYCECFQSN VLCSDNCKCM DCKNYESNEE RKAIRAQKHT VFVQNKQNYA  360
SSGILQPSSV LPRTTKNDSV TSMAASGIHH PTSNNGSSQI ILFKHTFQCC QLSCFLLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-2421534414130Protein lin-54 homolog
5fd3_B2e-2421534414130Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.6G097500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A368RLD20.0A0A368RLD2_SETIT; Uncharacterized protein
STRINGSi014947m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP138462025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.13e-48Tesmin/TSO1-like CXC domain-containing protein