PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G399200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 273aa    MW: 28213.9 Da    PI: 10.1249
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G399200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.12.2e-14190234347
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                         + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+eN +L  
  Sevir.5G399200.1.p 190 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAELLR 234
                         689*************************************98753 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-8188250IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415190232IPR004827Basic-leucine zipper domain
PfamPF001702.7E-13190236IPR004827Basic-leucine zipper domain
CDDcd147076.66E-19192242No hitNo description
Gene3DG3DSA:1.20.5.1707.4E-14193248No hitNo description
SuperFamilySSF579591.25E-10193236No hitNo description
PROSITE patternPS000360195210IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MASSRVMPSS SPSHTASDLA RFAQAASRPG GGGGSGLGSM NVEELLCGIY GDMPTPPPTA  60
SGANRPMPAA PAPAPGIASR KTAEEVWKEI TAGGGSGGAT AAPVPQAVVP AGAGGGAGAG  120
AGGPEMTLED FLAREGAVKE DEARISGPSA PAEGQVVMGF LGGAEGVGVA GGGGGRGRKR  180
QLMDPVDRAA MQRQKRMIKN RESAARSRER KQAYIAELES LVTQLEEENA ELLRGQEERH  240
QKRLKELLER VTPVIVRKKL SRDLRRTNSM QW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.5G399200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0541491e-138BT054149.1 Zea mays full-length cDNA clone ZM_BFb0134E03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816287.11e-124bZIP transcription factor 12
SwissprotQ0JHF12e-99BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A2S3HPN11e-122A0A2S3HPN1_9POAL; Uncharacterized protein
STRINGPavir.J05659.1.p1e-134(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.15e-27G-box binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]