PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G202100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CO-like
Protein Properties Length: 373aa    MW: 39530.3 Da    PI: 6.5921
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G202100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.64.5e-075498341
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         ++C+ +e  ++   C+ +   lC+ C   +H+       H +vp
  Sevir.4G202100.1.p 54 VWMCEVCELAPAAVTCKADAAVLCAACDADIHEAnplarrHVRVP 98
                        689*****************************7678888888877 PP

2CCT70.34.7e-24297340144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  Sevir.4G202100.1.p 297 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRA 340
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.15951IPR000315B-box-type zinc finger
CDDcd000214.10E-41256No hitNo description
SMARTSM003362.9E-135299IPR000315B-box-type zinc finger
PROSITE profilePS5011910.1115299IPR000315B-box-type zinc finger
CDDcd000214.35E-75599No hitNo description
PfamPF062038.5E-18297339IPR010402CCT domain
PROSITE profilePS5101716.896297339IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MELHKYWGVG GRRCGSCDAA PAAVHCRSCP AGGAFLCTAC DARPGHARLA HERVWMCEVC  60
ELAPAAVTCK ADAAVLCAAC DADIHEANPL ARRHVRVPVA PIGSEAAAAA VEAMLFGTAE  120
AAASEADEPH NAAAAAAAGH QHQHHHQHHA LNLNVEAKDM KLDYLFSDLD PYLSVEIPRF  180
QHADSVVPNG VGAGAGGAIE LDFTCGIGVK PSSYSSYTAT SLAHSGSSSE VGVVPEAFCG  240
GGGGSFELDF TRPKPQAYMP YTATPQSHSV SSVDVEVVPE RGDMAAARPV PLMGESREAR  300
LMRYREKRKN RRFEKTIRYA SRKAYAETRP RIKGRFAKRA DHDADADDAE AEAAVPSSSY  360
VLDFGYGVVP SF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.4G202100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965689.10.0zinc finger protein CONSTANS-LIKE 5
TrEMBLK3XXN20.0K3XXN2_SETIT; Uncharacterized protein
STRINGSi006690m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-35CONSTANS-like 5