PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G397100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 663aa    MW: 74787.6 Da    PI: 7.4043
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G397100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS286.29.4e-882896562373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         +++L+ cA+av+++d   a++lL++++++as++gd +qRla++f+++L+arl +++s++       + +  +  e l a +l+  +  + +
  Sevir.3G397100.1.p 289 RTTLILCAQAVAANDDMTASKLLKQIKQHASETGDVTQRLAQCFARGLEARLEGMGSQVR------QLRMADRLELLEACNLLTAAWSFNR 373
                         6789**************************************************665554......444445789999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +  l    +Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++gpp+++iT++g+p+    ske++eetg rL+k A+e+gvpf+f + 
  Sevir.3G397100.1.p 374 VVLLFSTMTILQAMVGKGRLHIVDYGMRYGFHWADLLRLLASREGGPPKVKITTIGHPNLRprSKEQIEETGYRLSKCAHEFGVPFNFYA- 463
                         *********************************************************999899***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         + k++e++++++L+++ gE+l+Vn  ++  +l+des   ++  ++d vL+ +++++P v++ +  ++++ ++s+l rf e + y++a+fd 
  Sevir.3G397100.1.p 464 IRKKWEEVSIKDLNTDAGEVLIVNDLMNFNTLMDESIFFDDpcPKDIVLHNIRKMRPAVFIQSIVNSSY-GPSYLSRFREVVFYFTAIFDI 553
                         7************************************99998899*********************999.899****************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a++pr+s+ r+++E+ l+gr++ n++aceg++  er e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l++g
  Sevir.3G397100.1.p 554 LDATIPRDSKLRVVLEQDLFGRSVLNAIACEGTDLMERPEKYKQWHARNQRAGLRQLPLKPSIVNVLKDKVMRCYHRDFLICEDGQWLLQG 644
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         W++r L++ S W
  Sevir.3G397100.1.p 645 WMGRILFAQSTW 656
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.243262637IPR005202Transcription factor GRAS
PfamPF035143.2E-85289656IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MATTPEELFV EGLKKSPQSP SVFLDVFSPK PDDRSEGCHH VPSDMVLSYI SRMLMEDDID  60
DKPSDHPALL QVQQPFAQIL SSPSFGSNHG DTEGANDLLQ DSSGDERTLH LALSKGTYAV  120
GAFLKGMKEA NMLLPIANNG FRRDKLVNQM VSESSNHSGA KKRYAXGAFL KGMKEANMLL  180
PIANNGFRRD ELVNQMVRES SNHSGAKKRY ASDDHIEEEE ARRTSKSLMM IKEPKDICAH  240
EMLEDMMLRG TETFIIRCME KLRIAMANEA EKSTRKGSTN AVANVVDIRT TLILCAQAVA  300
ANDDMTASKL LKQIKQHASE TGDVTQRLAQ CFARGLEARL EGMGSQVRQL RMADRLELLE  360
ACNLLTAAWS FNRVVLLFST MTILQAMVGK GRLHIVDYGM RYGFHWADLL RLLASREGGP  420
PKVKITTIGH PNLRPRSKEQ IEETGYRLSK CAHEFGVPFN FYAIRKKWEE VSIKDLNTDA  480
GEVLIVNDLM NFNTLMDESI FFDDPCPKDI VLHNIRKMRP AVFIQSIVNS SYGPSYLSRF  540
REVVFYFTAI FDILDATIPR DSKLRVVLEQ DLFGRSVLNA IACEGTDLME RPEKYKQWHA  600
RNQRAGLRQL PLKPSIVNVL KDKVMRCYHR DFLICEDGQW LLQGWMGRIL FAQSTWVADD  660
TS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-312886564374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964176.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-108GRAS family protein