PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G341100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 732aa    MW: 80562.9 Da    PI: 5.1887
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G341100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS368.77.8e-1133507211373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+s+d ++a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  + 
  Sevir.3G341100.1.p 350 LRTLLIHCAQAVASDDRRNATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVDILQAYQLYMAAICFK 437
                         6789************************************************************999998...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+ ++  Nq+I++a  g++++Hi+D++i +G+QWp++l+ +a+R++gpp++RiTg++ p++g   ++++eetg+rL+k+A+e+gvpf+++v
  Sevir.3G341100.1.p 438 KVVFIFSNQTIYNASLGKKKIHIVDYGIHYGFQWPCFLRRIACREGGPPEVRITGIDLPQPGfrPTQRIEETGRRLSKYAQEFGVPFKYQV 528
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++a+++e+++ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  + + +++ F++rf eal yysalfd l
  Sevir.3G341100.1.p 529 IAASKMETIRAEDLNLDPEEVLIVNCLYQFKNLMDESVLIESPRDIVLNNIRKMRPHAFIHAIVNGSFSAPFFVTRFREALFYYSALFDVL 619
                         ******************************************************************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         +++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++++ ++  +  ++ + + ++ ++++l++gW
  Sevir.3G341100.1.p 620 DTTTPRDSNQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPDVVQVVRDKVDGCYHKDFVIDIDHNWLLQGW 710
                         **************************************************************************889************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r L+++S W
  Sevir.3G341100.1.p 711 KGRILYAISTW 721
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.321324702IPR005202Transcription factor GRAS
PfamPF035142.7E-110350721IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MGSSYDPSPS PGAIADDLSF YLSDLGPTSP SAYLDLPPTP HHEQPQPQPQ PQPSYPQPNG  60
GAGAAASPED MVLPFISRML MEEDIDDKFF YEYPDHPALL QAQQPFLDIL SDDTSTSPSA  120
THSGASVSHP ASSCSSDAAN APLTPAAVDS YASAPGAQFN GFDLDPAAFF SDGANSDLMS  180
SAFLKGMEEA NKFLPSQDKL VIDLDPPEDA KRFVLPTENK FAAAGFNGSA PVAAAVAVKE  240
EVVAVAALDA VPGGGGGVGG RGRKNRFYDD EEDLEMDRRS SKQSALQGDG DDRDVFDKYM  300
ITSHEMCVEQ MEKLRIAMQE EAAKKEAVNG NGKAKAKGGG RRGGREVVDL RTLLIHCAQA  360
VASDDRRNAT ELLKQIKQHA SPQGDATQRL AHCFAEGLQA RLAGTGSMVY QSLMAKRTSA  420
VDILQAYQLY MAAICFKKVV FIFSNQTIYN ASLGKKKIHI VDYGIHYGFQ WPCFLRRIAC  480
REGGPPEVRI TGIDLPQPGF RPTQRIEETG RRLSKYAQEF GVPFKYQVIA ASKMETIRAE  540
DLNLDPEEVL IVNCLYQFKN LMDESVLIES PRDIVLNNIR KMRPHAFIHA IVNGSFSAPF  600
FVTRFREALF YYSALFDVLD TTTPRDSNQR MLIEQNIFGR AALNVIACEG TDRVERPETY  660
KQWQVRNQRA GLKQLPLNPD VVQVVRDKVD GCYHKDFVID IDHNWLLQGW KGRILYAIST  720
WVANDDAGSY F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-423547218374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002442368.10.0hypothetical protein SORBIDRAFT_08g018940
TrEMBLA0A096SPI30.0A0A096SPI3_MAIZE; Uncharacterized protein
STRINGGRMZM2G159475_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-157GRAS family protein