PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G233200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 258aa    MW: 26743 Da    PI: 9.6732
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G233200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.55.9e-13178226553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         +r++r++kNRe+A rsR RK+a+++eLe  v +Le+e  +L  e ee +
  Sevir.3G233200.1.p 178 QRQKRMIKNRESAARSRDRKQAYVAELESQVTQLEEEQAELLREQEERR 226
                         89************************************99988776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-6174235IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749176228IPR004827Basic-leucine zipper domain
PfamPF001701.7E-11177225IPR004827Basic-leucine zipper domain
CDDcd147071.21E-17178224No hitNo description
SuperFamilySSF579596.19E-11179227No hitNo description
Gene3DG3DSA:1.20.5.1707.5E-13179228No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MASSRVMASS SPPQPAGAGA GSSSDLARFR SGSGIGSMNM DDIIRNIYGP EAVNAAAAGG  60
GGAAEPSPAT PPAPAARRTS EEVWKEISAA GGLSVPALPP PPPAGGGGSG ARGGGGAAEM  120
TLEDFLARDS GARAAAAVEG CMALGFPVPD GDAPGGVGGG RGSRKRAMVD PADRAVMQRQ  180
KRMIKNRESA ARSRDRKQAY VAELESQVTQ LEEEQAELLR EQEERRQKRL TELMERAVPV  240
IRKKLPQDLR RTNSMEW*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.3G233200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961953.11e-180G-box-binding factor 4
SwissprotQ0JHF11e-59BZP12_ORYSJ; bZIP transcription factor 12
TrEMBLA0A368QHW41e-179A0A368QHW4_SETIT; Uncharacterized protein
STRINGPavir.J06257.1.p1e-110(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-16bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]