PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G450000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 625aa    MW: 67446.8 Da    PI: 5.9101
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G450000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3458.64.6e-140704611354
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el++r w+d+++l+rlke+++q+     +  +  + ++s+eqarrkkmsraQDgiLkYMlk+mevc aqGfvYgiipe+gkpv+gasd+L
  Sevir.2G450000.1.p  70 DELERRIWRDRVRLRRLKEQQLQQQRGGGRGKEVPRARQSQEQARRKKMSRAQDGILKYMLKMMEVCSAQGFVYGIIPENGKPVTGASDNL 160
                         79*********************988888778999999***************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fdrngpaa++ yq    + +g+ +  +++ + +hsl+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G e ww+
  Sevir.2G450000.1.p 161 RAWWKEKVRFDRNGPAAVARYQ---GAGGGDGGAVAAAPAGPHSLHELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPQGAEPWWP 248
                         *********************5...46666666677899**************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqs 271
                         e+g++++ g+ppykkphdlkkawkv+vLtavikhmsp+++++r+l+rqsk+lqdkm+a+e  ++l+vl+qee+++  +++   ++ +++++
  Sevir.2G450000.1.p 249 EAGVPRELGPPPYKKPHDLKKAWKVAVLTAVIKHMSPDVDKVRRLVRQSKCLQDKMTAREIVTWLAVLKQEEDLYLMLHPGahPPPCSTNA 339
                         ****************************************************************************999886555555555 PP

                         XXXXXX.XXXXXXXXXXXXXX.XXXXXXXXXX....................................XXXXXXXXXXXXX..XXXXXXXX CS
                EIN3 272 pkvtls.ceqkedvegkkeskikhvqavktta....................................gfpvvrkrkkkps..esakvssk 323
                          ++ +s ++ ++dv+g ++ + +++++ k                                       ++++ +kr + p+  e++ + s+
  Sevir.2G450000.1.p 340 AALPFSaSSGEYDVDGADDGE-ETARNTKPSPndapafvdlsssmdadattgnnrflmpaalmkeeaaDAELFQKRSAVPAavEPELMLSN 429
                         555554155699***666555.333333333356899***************************************987651155555554 PP

                         .......XXXXXXX.XXXXXXXXXXXXXXXXX CS
                EIN3 324 .evsrtcqssqfrgsetelifadknsisqney 354
                             +tc ++q+++s+  ++f d+++++ ++y
  Sevir.2G450000.1.p 430 sFRAYTCGNAQCPHSSCVHGFLDRSARNTHQY 461
                         2678**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.5E-12470320No hitNo description
Gene3DG3DSA:1.10.3180.102.6E-69198328IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.94E-58200323IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MMGGGPLLLD HRLPLPADDK GALFSGFGGD CFFGEGDLVN PPPPAHDEIM SFPGGDDSDD  60
GDDDVVGGID ELERRIWRDR VRLRRLKEQQ LQQQRGGGRG KEVPRARQSQ EQARRKKMSR  120
AQDGILKYML KMMEVCSAQG FVYGIIPENG KPVTGASDNL RAWWKEKVRF DRNGPAAVAR  180
YQGAGGGDGG AVAAAPAGPH SLHELQDTTL GSLLSALMQH CDPPQRRFPL EKGVPPPWWP  240
QGAEPWWPEA GVPRELGPPP YKKPHDLKKA WKVAVLTAVI KHMSPDVDKV RRLVRQSKCL  300
QDKMTAREIV TWLAVLKQEE DLYLMLHPGA HPPPCSTNAA ALPFSASSGE YDVDGADDGE  360
ETARNTKPSP NDAPAFVDLS SSMDADATTG NNRFLMPAAL MKEEAADAEL FQKRSAVPAA  420
VEPELMLSNS FRAYTCGNAQ CPHSSCVHGF LDRSARNTHQ YACKFNSPAV APSAATDNNK  480
LLAPSVFLPP GQAVGGFDFD VPVDGQRSLA ELMDMYEANV GTSRSLSNTD MVATGGVQVS  540
GQFLTPCLFG NLNQPQQQQQ QSAGFYVRDD ALPFGGDIAG ASPELRFSSG LDGVAVGTSS  600
HYGGALQLQQ PQPHKPAAGS NWFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-681973281132Protein ETHYLENE INSENSITIVE 3
4zds_B2e-681973281132Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a positive regulator in the ethylene response pathway (PubMed:19798512, PubMed:25995326). Involved in wound signaling by binding specifically to the DNA sequence 5'-ATGTACCT-3' found in the promoter of some wound-inducible genes (PubMed:19798512). Required for ethylene-promoted coleoptile elongation (PubMed:25995326). Acts as negative regulator of salt tolerance (PubMed:25995326). During salt stress, activates the cation transporter HKT1, which mediates increased sodium uptake in roots, and contributes to sodium accumulation and salt toxicity (PubMed:25995326). Possesses transactivation activity in protoplasts (PubMed:25995326). {ECO:0000269|PubMed:19798512, ECO:0000269|PubMed:25995326}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G450000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding and metyhl jasmonate. {ECO:0000269|PubMed:19798512}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958734.10.0ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotQ8W3L90.0EIL2_ORYSJ; Protein ETHYLENE-INSENSITIVE 3-like 2
TrEMBLK3ZRI30.0K3ZRI3_SETIT; Uncharacterized protein
STRINGSi029213m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.11e-142ETHYLENE-INSENSITIVE3-like 1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Yilmaz A, et al.
    GRASSIUS: a platform for comparative regulatory genomics across the grasses.
    Plant Physiol., 2009. 149(1): p. 171-80
    [PMID:18987217]
  3. Yang C, et al.
    MAOHUZI6/ETHYLENE INSENSITIVE3-LIKE1 and ETHYLENE INSENSITIVE3-LIKE2 Regulate Ethylene Response of Roots and Coleoptiles and Negatively Affect Salt Tolerance in Rice.
    Plant Physiol., 2015. 169(1): p. 148-65
    [PMID:25995326]