PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G289200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family TCP
Protein Properties Length: 333aa    MW: 33960.7 Da    PI: 4.4055
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G289200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.91.1e-3173149783
                 TCP   7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                         r  ++hTkv+gR+RR+R+ a+caar+  L++ LG+++d++t+ WLlqq++pai+++tgt++ +a +++ ++ +    
  Sevir.2G289200.1.p  73 RYRDRHTKVEGRGRRIRMAAPCAARVARLTRDLGHKSDGETVRWLLQQSEPAIIAATGTGTVPAIAVTGSDGVLRLP 149
                         678********************************************************988886663333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136923.47174128IPR017887Transcription factor TCP subgroup
PfamPF036349.1E-2575137IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MESRAPGRDE EDAEALFLAA EAVGNGAAAA VTVAVDAMGS VQADGSGLPK PEPVPVEFLG  60
GGLQLANPRP APRYRDRHTK VEGRGRRIRM AAPCAARVAR LTRDLGHKSD GETVRWLLQQ  120
SEPAIIAATG TGTVPAIAVT GSDGVLRLPA EPPPADADGE QQDPAPKRRR KLQPTRAAAG  180
PSAPAPAAYY PFVADPLLQA NGGGAISISS GLAPASAPAG PAGAIPFLAI PAPAPGASGD  240
GKQVIPTAAM WMVPQQVGAA GAANQPTHFW AFPTNPELFN VGNFQQQAVY DAEQLAGNGD  300
SEDQQFGGHQ IGEGEGEGED EEIAVTDSSS EE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165171PKRRRKL
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G289200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957394.10.0transcription factor PCF2
SwissprotA2YXQ16e-79PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH66e-79PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A368Q3H90.0A0A368Q3H9_SETIT; Uncharacterized protein
STRINGSi030591m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.18e-34TCP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]