PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G264700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 609aa    MW: 67863.1 Da    PI: 5.7284
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G264700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3429.43.5e-131384151352
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         e+l +rmwkd+++l+r+ker+++l   ++a++++++ + +++qa rkkmsraQDgiLkYMlk mevcna+GfvYgiip+kgkpv+gasd++
  Sevir.2G264700.1.p  38 EDLARRMWKDRVRLRRIKERQQKLA-LQQAELEKSRPKPISDQAMRKKMSRAQDGILKYMLKLMEVCNARGFVYGIIPDKGKPVSGASDNI 127
                         89*******************9865.66667************************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai ky+++nl+ s+++s    + +++hsl++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWP+G+e+ww 
  Sevir.2G264700.1.p 128 RAWWKEKVKFDKNGPAAIEKYESENLVTSNAQSG---GIKNQHSLMDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPSGNEEWWI 215
                         *****************************99888...88**************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX....XXXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah....ssslrk 269
                         + gl+  q  ppykkphdlkk+wkv+vLt vikhmsp++++ir+++r+sk+lqdkm+akes ++l vl++ee+++++         +sl +
  Sevir.2G264700.1.p 216 ASGLPSGQI-PPYKKPHDLKKVWKVGVLTGVIKHMSPNFDKIRNHVRKSKCLQDKMTAKESLIWLGVLQREERLVHRTDNGvlatHHSLLE 305
                         ******999.9**************************************************************998766665432447777 PP

                         XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.................................XXXXXXXXXXXXXXXXXXXXX.... CS
                EIN3 270 qspkvtlsceqkedvegkkeskikhvqavktta.................................gfpvvrkrkkkpsesakvsskevsr 327
                         ++   t s+++++dv+g ++   ++++++++++                                 g++   krk+ +++s+ v+      
  Sevir.2G264700.1.p 306 DRHGETNSSSNEYDVDGFEDAPLSTSSKDDEQDpspvaqsaenhvlkkgreraynkrssqvvpskaGTKEPPKRKRARHSSTVVEPD---- 392
                         88888888899*****88888889999999988999999999999999999999999999999998888888888777777777666.... PP

                         ..XXXXXXX.XXXXXXXXXXXXXXX CS
                EIN3 328 tcqssqfrgsetelifadknsisqn 352
                           q+   ++ ++++ ++d+n+++q 
  Sevir.2G264700.1.p 393 -VQRVDAPE-NSRNLIPDMNRLDQV 415
                         .57778875.577788888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.2E-12638286No hitNo description
Gene3DG3DSA:1.10.3180.109.6E-70161292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-60166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MDQLAIIASE LGDSSDFEVE GIQNLTENDV SDEEIEPEDL ARRMWKDRVR LRRIKERQQK  60
LALQQAELEK SRPKPISDQA MRKKMSRAQD GILKYMLKLM EVCNARGFVY GIIPDKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAIEKYES ENLVTSNAQS GGIKNQHSLM DLQDATLGSL  180
LSSLMQHCDP PQRKYPLEKG TPPPWWPSGN EEWWIASGLP SGQIPPYKKP HDLKKVWKVG  240
VLTGVIKHMS PNFDKIRNHV RKSKCLQDKM TAKESLIWLG VLQREERLVH RTDNGVLATH  300
HSLLEDRHGE TNSSSNEYDV DGFEDAPLST SSKDDEQDPS PVAQSAENHV LKKGRERAYN  360
KRSSQVVPSK AGTKEPPKRK RARHSSTVVE PDVQRVDAPE NSRNLIPDMN RLDQVEVQGM  420
ATQIVSFNHG GTTSVSLQHR GDTQVQVHLP DVEANSFDSA PAANATPTII YMGGQHLPYQ  480
NSDSARSISE NNFVADDDPG LNNLPSGYQT LPPKQSLPLS MMDQHVVPMG IKAPTDNIPY  540
GDHMLGGNST SVPGDMQQLI DFPFYGEQDK FAGSSFEGLP LDYISISSPI PDIDDLLHDD  600
DLMEYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A6e-661662929135ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSevir.2G264700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957192.10.0ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_004957193.10.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-146EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK3ZRM90.0K3ZRM9_SETIT; Uncharacterized protein
STRINGSi029258m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-143ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]